Publications Citing JPT's Control Pools
References with PepMix™ Peptide Pools - Control Pools
2025
2025
- Effects of Notch signaling on the lineage commitment of human peripheral blood monocyte trilineage progenitor under inflammatory conditions
Aničić et al., Cell Death Discovery (2025) - PMID: 41213920
Product used: CEFSX Ultra SuperStim Pool - Adaptive immune responses to SARSCoV-2 in DMARD-treated patients with chronic inflammatory rheumatisms
Beretta et al., Rheumatic & Muscosceletal Diseases (2025) - PMID: 40617588
Products used: PepMix™ SARS-CoV-2 (Spike Glycoprotein), EF Pool - Immune profiling in solid organ transplant recipients with HHV-8 infection: Identification of immunological biomarkers for KICS and Kaposi’s sarcoma
Busà et al., Clinical Immunology (2025) - PMID: 40651737
Products used: CEFX Ultra SuperStim Pool, Custom PepMix™ (HHV8) - Systemic immunomodulation by irreversible electroporation versus stereotactic ablative body radiotherapy in locally advanced pancreatic cancer: the CROSSFIRE trial
Geboers et al., Journal for ImmunoTherapy of Cancer (2025) - PMID: 40139834
Products used: PepMix™ Human (Survivin), PepMix™ Human (WT1/WT33), CEFT Pool - CD137 Signaling Modulates Vein Graft Atherosclerosis by Driving T-Cell Activation and Regulating Intraplaque Angiogenesis
De Jong et al., JACC. Basic to translational medicine (2025) - PMID: 40737954
Products used: CEFX Ultra SuperStim Pool - Conditional generation of real antigen-specific T cell receptor sequences
Karthikeyan et al., Nature Machine Intelligence (2025)
Products used: CEFX Ultra SuperStim Pool MHC-I Subset, Antigen Peptide HA-1 (His139) HLA-A*0201 (VLHDDLLEA) - BASTA, a simple whole blood assay for measuring b-cell antigen specific CD4+ 2 T-cell responses in type 1 diabetes
Lacorcia et al., BioRxiv et al., (2025)
Product used: CEFX Ultra SuperStim Pool - Utilization of primary tumor samples for cancer neoantigen discovery
Leko et al., Journal of Immunotherapy of Cancer (2025)
Product used: CEFX Ultra SuperStim Pool - ESPEC-SUIT: a versatile and robust platform to identify and track antigen-specific T cell receptors in patients with cancer
Lindner et al., Journal of Immunotherapy for Cancer (2025) - PMID: 40983341
Products used: CEFX Ultra SuperStim Pool, Antigen Peptide EBV BMLF1 HLA-A*0201 (GLCTLVAML), Influenza A MP (58-66) Peptide (GILGFVFTL), Antigen Peptide Influenza HA HLA-DRB 0101 (PKYVKQNTLKLAT), Antigen Peptide CMV pp65 - HLA-A*0201 (NLVPMVATV), MOG (35-55), Mouse Peptide (MEVGWYRSPFSRVVHLYRNGK), custom Peptide: TpD(ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ) - Dosing interval is a major factor determining the quality of T cells induced by SARS-CoV-2 mRNA and adenoviral vector vaccines
Murray et al., Science Immunology (2025) - PMID: 40880518
Products used: CEFT MHC-II Pool, PepMix™ SARS-CoV-2 (Spike Glycoprotein SUB1 & SUB2) - Loss of SMARCA4 leads to Intron Retention and Generation of Tumor-Associated Antigens in Small Cell Carcinoma of the Ovary, Hypercalcemic Type
Raupach et al., AACR Journals (2025)
Products used: SpotMix Antigen Discovery Pools & CEFX Ultra SuperStim Pool - Massively parallel immunopeptidome by DNA sequencing provides insights into cancer antigen presentation
Shi et al., Nature Genetics (2025) - PMID: 40721532
Products used: CEFT Pool - Autologous HIV-specific T cell therapy targeting conserved epitopes is welltolerated in six adults with HIV: an openlabel, single-arm phase 1 study
Sohai et al., Nature Communications (2025)
Products used: PepMix™ Human (Actin), PepMix™ HIV-1 (NEF) Ultra, PepMix™ HIV-1 (GAG) Ultra, PepMix™ HIV-1 (POL) Ultra - Evaluation der SARS-CoV-2 spezifischen T Zell Response mittels FACS basierten Assay bei Multiple Sklerose Patienten unter immunmodulatorischer Therapie
Solchenberger, Dissertation (2025)
Product used: PepMix™ Human CMV (pp65) - Immunopeptidomics analysis of human atherosclerosis plaques identifies antigenic drivers of atherosclerosis
Vigario et al., Atherosclerosis (2025) - PMID: 40916277
Product used: PepMix™ Human (Actin) - Zika but not Dengue virus infection limits NF-κB activity in human monocyte-derived dendritic cells and suppresses their ability to activate T cells
Wang et al., Nature Communications (2025)
Products used: CEFT MHC-II Pool, EFX Ultra SuperStim Pool - A pathogenic subpopulation of human glioma associated macrophages linked to glioma progression
Yu et al., BioRxiv (2025)
Product used: CEF Pool (standard)
2024
2024
- Characterizing the Effect of JAK Inhibition on CMV Virus-specifc T-cell Function
Rajah et al., Fusion (2024)
Products used: PepMix™ Human CMV (pp65), PepMix™ Human CMV (IE-1) - Type I interferon and mitochondrial dysfunction are associated with dysregulated cytotoxic CD8+ T cell responses in juvenile systemic lupus erythematosus
Radziszewska et al., Clinical & Experimental Allergy (2024) - PMID: 39719886
Products used: CEFX Ultra SuperStim Pool MHC-I Subset - Phase I trial of viral vector based personalized vaccination elicits robust neoantigen specific antitumor T cell responses
D'Alise et al., Clinical Cancer Research (2024) - PMID: 38506710
Product used: CEFX Ultra SuperStim Pool - Investigation of Putative Tumor-Specific T Cell Receptors and their Corresponding T Cell Epitopes in Newly Diagnosed Multiple Myeloma Patients
Werner et al., Thesis (2024)
Product used: CEFT Pool - A T cell receptor specific for an HLA‑A*03:01‑restricted epitope in the endogenous retrovirus ERV‑K‑Env exhibits limited recognition of its cognate epitope
Grundy et al., Mobile DNA (2024) - PMID: 39385229
Product used: PepMix™ Human (Actin), PepMix™ Human (Prame/OIP4) - T cell responses and clinical symptoms among infants with congenital cytomegalovirus infection
Medoro et al., JCI Insight (2024) - PMID: 39315550
Product used: PepMix™ Human CMV (pp65) - An in vitro CD8 T-cell priming assay enables epitope selection for hepatitis C virus vaccines
Koutsoumpli et al., Vaccine (2024)
Product used: CEF Pool (standard) - Multiparametric analysis of the specific immune response against SARS-CoV-2
Vránová et al., Infectious Diseases (2024)
Product used: CEF Pool (extended) - Effects of the induction of humoral and cellular immunity by third vaccination for SARS-CoV-2
Murayama et al., Journal of Infection and Chemotherapy (2024) - PMID: 38570139
Product used: CEFT Pool - Transcriptional signature of durable effector T cells elicited by a replication defective HCMV vaccine
Ye et al., Vaccines (2024) - PMID: 38561339
Product used: PepMix™ HCMVA (pp65) - Ocrelizumab Alters Cytotoxic Lymphocyte Function While Reducing EBV-Specific CD8+ T-Cell Proliferation in Patients With Multiple Sclerosis
Abbadessa et al., Neurolog. Neuroimmunology Neuroinflammation (2024) - PMID: 38662990
Products used: CEFX Ultra SuperStim Pool - The neo-open reading frame peptides that comprise the tumor framome are a rich source of neoantigens for cancer immunotherapy
Martin et al., Cancer Immunology (2024)
Product used: CEFT Pool - Antiviral cellular therapy for enhancing T-cell reconstitution before or after hematopoietic stem cell transplantation (ACES): a two-arm, open label phase II interventional trial of pediatric patients with risk factor assessment
Keller et al., Nature Communications (2024)
Product used: PepMix™ Human (Actin) - Secondary bone marrow graft loss after third-party virus-specific T cell infusion: Case report of a rare complication
Keller et al., Nature Communications (2024)
Product used: PepMix Human (Actin) - A shared neoantigen vaccine combined with immune checkpoint blockade for advanced metastatic solid tumors: phase 1 trial interim results
Rappaport et al., Nature Medicine (2024) - PMID: 38538867
Product used: CEF Pool (standard) - Comparable CD8+ T‐cell responses to SARS‐CoV‐2 vaccination in single‐cell transcriptomics of recently allogeneic transplanted patients and healthy individuals
Tranter et al., Journal of Medical Virology (2024) - PMID: 38516755
Products used: CEFX Ultra SuperStim Pool, PepMix SARS-CoV-2 (NCAP), SARS-CoV-2 (Spike Glycoprotein SUB1 & SUB2), AP3A (ORF3a), NS7A, NS8, Pan‐SARS2 select, and custom‐made pools containing cross‐reactive epitopes with spike or without spike and the single peptide S816‐830 (N′‐SFIEDLLFNKVTLAD‐C′) - Phase I trial of viral vector based personalized vaccination elicits robust neoantigen specific antitumor T cell responses
D'Alise et al., Clinical Cancer Research (2024) - PMID: 38506710
Product used: CEFX Ultra SuperStim Pool - Keratinocyte-derived small extracellular vesicles supply antigens for CD1a-resticted T cells and promote their type 2 bias in the context of filaggrin insufficiency
Kobiela et al., Frontiers in Immunology (2024) - PMID: 38585273
Product used: CEFT Pool - mRNA-1273 vaccinated inflammatory bowel disease patients receiving TNF inhibitors develop broad and robust SARS-CoV-2-specific CD8+ T cell responses
Van Den Dijssel et al., Journal of Autoimmunity (2024) - PMID: 38387105
Product used: CEF Pool (standard) - MVA-based vaccine candidates encoding the native or prefusion-stabilized SARS-CoV-2 spike reveal differential immunogenicity in humans
Mayer et al., Vaccines (2024) - PMID: 38278816
Products used: CEF Pool (extended), PepMix™ SARS-CoV-2 (Spike Glycoprotein) - Lymph-node-targeted, mKRAS-specific amphiphile vaccine in pancreatic and colorectal cancer: the phase 1 AMPLIFY-201 trial
Pant et al., Nature Medicine (2024) - PMID: 38195752
Products used: PepMix SARS-CoV-2 (S-RBD), CEFSX Ultra SuperStim Pool, CEFT Pool, PepMix™ Pan-CMV Select, PepMix CMVA pp65, PepMix™ Pan-EBV Select, CEF Pool (standard) - H3K27M neoepitope vaccination in diffuse midline glioma induces B and T cell responses across diverse HLA loci of a recovered patient
Boschert et al., Science Advances (2024) - PMID: 38306431
Products used: CEFX Ultra SuperStim Pool - Impaired T and "memory-like" NK-cell reconstitution is linked to late-onset HCMV reactivation after letermovir cessation
Lauruschkat et al., Blood Advances (2024) - PMID: 38315873
Products used: PepMix™ CMVA (pp65), PepMix™ HIV-1 (NEF) Ultra
Archive
Archive
- Lymph-node-targeted, mKRAS-specific amphiphile vaccine in pancreatic and colorectal cancer: the phase 1 AMPLIFY-201 trial
Pant et al., Nature Medicine (2024) - PMID: 38195752
Product used: PepMix™ SARS-CoV-2 (S-RBD), CEFSX Ultra SuperStim Pool, CEFT Pool, PepMix™ Pan-CMV Select, PepMix CMVA pp65, PepMix™ Pan-EBV Select, CEF Pool (standard) - Photothermal Prussian blue nanoparticles generate potent multi-targeted tumor-specific T cells as an adoptive cell therapy
Sweeney et al., Bionengineering and Translational Medicine
Product used: PepMix™ Human (Actin) - Charakterisierung von T-Stammzell-Gedächtnis Zellen (TSCM) in verschiedenen Alterkohorten Characterization of T Stem Cell Memory Cells in distinct Age bands
Hasselmann, Dissertation (2023)
Products used: PepMix™ CMVA (pp65), PepMix™ CMVA (IE-1) - A novel Shiga toxin 2a neutralizing antibody therapeutic with low immunogenicity and high efficacy
Kirkland et al., Antimicrobial Agents and Chemotherapy
Product used: CEFT Pool, PepMix™ Human (MOG) - Identification of novel canonical and cryptic HCMV-specific T-cell epitopes for HLA-A*03 and HLA-B*15 via peptide-PRISM
Rein et al., Blood Advances (2023)
Product used: PepMix™ CMVA (pp65) - Cytomegalovirus-Specific T Cells in Pediatric Liver Transplant Recipients
Getsuwan et al., Viruses (2023)
Products used: PepMix CMVA (IE-1), PepMix CMVA (pp65) - Structural surfaceomics reveals an AML-specific conformation of integrin β2 as a CAR T cellular therapy target
Mandal et al., Nature Cancer (2023)
Products used: PepMix EBV (LMP1), EBV (EBNA1), EBV (LMP2), EBV (BZLF1), EBV (BRLF1), PepMix CMVA (pp65), PepMix CMVA (IE-1) - Identification and validation of neoepitope-specific T cell receptors for glioma immunotherapy
Lindner, Dissertation (2023)
Product used: CEF Pool (standard) - Individualized, heterologous chimpanzee adenovirus and self-amplifying mRNA neoantigen vaccine for advanced metastatic solid tumors: phase 1 trial interim results
Palmer et al., Nature Medicine (2023) - PMID: 35970920
Product used: CEF Pool (standard) - Identifizierung und Charakterisierung antigenspezifischer T-Zell-Antworten gegen Glioblastome
Lu, Dissertation (2023)
Products used: human TAAs & CEF Pool (standard) - Long-term outcome of progressive multifocal leukoencephalopathy with recombinant interleukin-2 treatment and an associated increase in the number of HPyV-2-specific T-cells: a case report
Hoff et al., Therapeutic Advances in Hematology (2023) - PMID: 37822572 - Polyfunctional CD4 T-cells correlating with neutralising antibody is a hallmark of COVISHIELDTM and COVAXIN® induced immunity in COVID-19 exposed Indians
Rakshit et al., NPJ Vaccines (2023) - PMID: 37709772
Product used: CEFT Pool - U54 SCENT Intracellular Staining (ICS) Senescence Flow Cytometry Panel
Healy et al., Scent, Protocol
Products used: CEF Pool (extended), CEFX Ultra SuperStim Pool - Ablative radiation alone in stage I lung cancer produces an adaptive systemic immune response: insights from a prospective study
Voong et al., Journal for ImmunoTherapy of Cancer (2023)
Products used: CEFX Ultra SuperStim Pool MHC-II Subset & PepMix™ HIV-1 (GAG) Ultra - Activating Inducible T cell Co-stimulator (ICOS) yields anti-tumor activity alone and in combination with anti-PD-1 checkpoint blockade
Yadavilli et al., AACR Journals (2023)
Products used: CEFT Pool - Exercise mobilizes diverse antigen specific T-cells and elevates neutralizing antibodies in humans with natural immunity to SARS CoV-2
Baker et al., Brain Behaviour & Immunity (2023) - PMID: 36743994
Products used: PepMix Human (Actin) & SARS-CoV-2 (Spike Glycoprotein) - CD40 ligand stimulation affects the number and memory phenotypes of human peripheral CD8+ T cells
Choi et al., BMC Immunology (2023) - PMID: 37391734
Product used: PepMix CMVA (pp65) - GRT-R910: a self-amplifying mRNA SARSCoV-2 vaccine boosts immunity for ≥6months in previously-vaccinated older adults
Palmer et al., Nature Communications (2023) - PMID: 37280238
Product used: CEF Pool (standard) - Antigen specificities of HIV-infected cells: A role in infection and persistence?
Faua et al., Journal of Virus Eradication (2023)
Product used: CEFT MHC-II Pool & PepMix CMVA (pp65) - The pre-existing T cell landscape determines the response to bispecific T cell engagers in multiple myeloma patients
Friedrich et al., Cancer Cell (2023) - PMID: 36898378
Product used: CEFT Pool - Comparison of intracellular cytokine staining versus an ELISA‐based assay to assess CMV‐specific cell‐mediated immunity in high‐risk kidney transplant recipients
Fernández‐Ruiz et al., Journal of Medical Virology (2023)
Product used: PepMix HCMVA (pp65) - Untersuchungen zur Kreuzreaktivität von Cytomegalievirusspezifischen T-Lymphozyten und Tumorassoziierten Antigenen
Weiß, Dissertation (2023)
Products used: PepMix CMVA (pp65), Human (Mucin-1), Human (NY-ESO-1), Human (Prame/OIP4) & Human (WT1/WT33) - Validation of the performance and suitability of a new class of FBS optimized for use in single-cell functional assays
Berrong et al., Journal of Immunological Methods (2023) - PMID: 36858170
Product used: CEF Pool (extended), CEFT MHC-II Pool & PepMix™ CMVA (pp65) - Cardiac antigen derived T cell epitopes in the frame of myocardial infarction
Hapke et al., Dissertation (2023) - Age-related Differences in Immune Reactions to SARS-CoV-2 Spike and Nucleocapsid Antigens
Morhart et al,. In Vivo (2023)
Products used: PepMix CEFX Ultra SuperStim Pool & PepMix Human (Actin) - Diminished responses to mRNA-based SARS-CoV-2 vaccines in individuals with rheumatoid arthritis on immune modifying therapies
Klebanoff et al., MedRxiv (2023)
Products used: CEFX Ultra SuperStim Pool & PepMix SARS-CoV-2 (Spike Glycoprotein) - Filaggrin insufficiency renders keratinocyte-derived small extracellular vesicles capable of modulating CD1a-mediated T cell responses
Kobiela et al., Research Square (2022)
Product used: CEFT Pool - Immune Response after the Fourth of SARS-CoV-2 mRNA Vaccine Compared to Natural Infection in Three Doses' Vaccinated Solid Organ Transplant Recipients
Busà et al,. Vaccines (2022) - PMID: 36298854
Products used: PepMix SARS-CoV-2 (Spike Glycoprotein), SARS-CoV-2 (NCAP) and CEFX Ultra SuperStim Pool - Personalized neoantigen vaccine NEO-PV-01 with chemotherapy and anti-PD-1 as first-line treatment for non-squamous non-small cell lung cancer
Awad et al., Cancer Cell (2022) - PMID: 36027916
Product used: PepMix CEF Pool (extended) - Individualized, heterologous chimpanzee adenovirus and self-amplifying mRNA neoantigen vaccine for advanced metastatic solid tumors: phase 1 trial interim results
Palmer et al., Nature Medicine (2022)
Product used: PepMix CEF Pool (standard) - Protective antibodies and T cell responses to Omicron variant after the booster dose of BNT162b2 vaccine
Naaber et al., Cell Reports Medicine (2022)
Product used: PepMix CEFX Ultra Super Stim Pool - Brief Research Report: Anti-SARS-CoV-2 Immunity in Long Lasting Responders to Cancer Immunotherapy Through mRNA-Based COVID-19 Vaccination
Sistere-Oro et al., Frontiers in Immunology (2022)
Product used: PepMix CEF Pool Standard - Persistence of MERS-CoV-spike-specific B cells and antibodies after late third immunization with the MVA-MERS-S vaccine
Weskamm et al., Cell Reports Medicine (2022) - PMID: 35858586
Product used: PepMix CEF Pool (extended) - Antibody and cellular immune responses following dual COVID-19 vaccination within infection-naive residents of long-term care facilities: an observational cohort study
Tut et al., The Lancet (2022)
Product used: PepMix CEFX Ultra SuperStim Pool - An Autologous Dendritic Cell Vaccine Promotes Anticancer Immunity in Patients with Ovarian Cancer with Low Mutational Burden and Cold Tumors
Fucikova et al., Clinical Cancer Research (2022) - PMID: 35536547
Product used: PepMix CEFT Pool
- Respiratory viral infections in otherwise healthy humans with inherited IRF7 deficiency
Campbell et al., Journal of Experimental Medicine (2022) - PMID: 35670811
Products used: PepMix CEFX Ultra SuperStim Pool, PepMix CMVA (IE-1 , IE-2 & pp65), - Robust SARS-CoV-2-specific and heterologous immune responses in vaccine-naïve residents of long-term care facilities who survive natural infection
Tut et al., Nature Aging (2022) - Distinct phenotypic states and spatial distribution of CD8+ T cell clonotypes in human brain metastases
Sudmeier et al., Cell Reports Medicine (2022)
Product used: PepMix CEFX Ultra SuperStim Pool - Landscape of helper and regulatory antitumour CD4+ T cells in melanoma
Oliveira et al., Nature (2022) - PMID: 35508657 - Protective antibodies and T cell responses to Omicron variant three months after the booster dose of BNT162b2 vaccine
Naaber et al., MedRxiv (2022)
Product used: CEFX Ultra SuperStim Pool - Broad SARS-CoV-2 spike-specific CD4+ T-cell response preserves recognition of variants of concern
Long et al., Research Square (2022)
Product used: CEFX Ultra SuperStim Pool MHC-II Subset - Imprinted SARS-CoV-2-specific memory lymphocytes define hybrid immunity
Rodda et al., MedRxiv (2022)
Products used: CEFX Ultra SuperStim Pool - A Co-stimulatory CAR Improves TCR-based Cancer Immunotherapy
Omer et al., Cancer Immunology (2022) - PMID: 35176142 - Development of an effective immune response in adults with Down Syndrome 2 after SARS-CoV-2 vaccination
Esparcia-Pinedo et al., MedRxiv (2022)
Products used: PepMix™ Human (Actin) - T-cells of invasive candidiasis patients show patterns of T-cell-exhaustion suggesting checkpoint blockade as treatment option
Sibylle C.Mellinghoff et al., MedRxiv (2021) - PMID: 34921845 - TGM4: An Immunogenic Prostate-Restricted Antigen
Lopez-Bujanda, Z.A. et al., J Immunother Cancer (2021) - Anti-CD38 Therapy Impairs SARS-CoV-2 Vaccine Response in Multiple Myeloma Patients
S. Henriquez et al., medRxiv, (2021) - Acute Exercise Increases Immune Responses to SARS CoV-2 in a Previously Infected Man
Baker, F.L. et al., Brain Behav Immun Health (2021) - Dynamics of Antibody Response to BNT162b2 Vaccine After Six Months: a Longitudinal Prospective Study
Naaber, Paul et al., Lancet Reg Health Eur, (2021) - Identification of a Class of Non-Conventional ER-Stress-Response-Derived Immunogenic Peptides
Melacarne, Alessia et al., Cell Rep, (2021) - Adaptive Subsets Limit the Anti-Tumoral NK-Cell Activity in Hepatocellular Carcinoma
Rennert, Charlotte et al., Cells, (2021) - Monitoring Cell-Mediated Immune Responses in AAV Gene Therapy Clinical Trials Using a Validated IFN-γ ELISpot Method
Patton, K.S. et al., Mol Ther Methods Clin Dev, (2021) - Gene Transfer in Adeno-Associated Virus Seropositive Rhesus Macaques Following Rapamycin Treatment and Subcutaneous Delivery of AAV6, but Not Retargeted AAV6 Vectors
Stone, Daniel et al., Human Gene Ther, (2021) - Identification of Neoantigen-Reactive T Lymphocytes in the Peripheral Blood of a Patient With Glioblastoma
Leko, V. et al., J Immunother Cancer, (2021) - Circulatory Follicular Helper T Lymphocytes Associate With Lower Incidence of CMV Infection in Kidney Transplant Recipients
Suàrez-Fernández, P. et al., Am J Transplant, (2021) - A Glimpse into the Diverse Cellular Immunity Against SARS-CoV-2
Chang, Cheng-Wei et al., Vacinnes, (2021) - Tick-Borne Encephalitis Specific Lymphocyte Response after Allogeneic Hematopoietic Stem Cell Transplantation Predicts Humoral Immunity after Vaccination
Harrison, Nicole et al., Vaccines, (2021) - HIV-Specific T Cell Responses Reflect Substantive in Vivo Interactions With Antigen Despite Long-Term Therapy
Stevenson, E.M. et al., JCI Insight, (2021) - Identification of Naturally Processed Zika Virus Peptides by Mass Spectrometry and Validation of Memory T Cell Recall Responses in Zika Convalescent Subjects
Crooke, S.N. et al., PLoS One, (2021) - Pre-Transplant Cytomegalovirus-Specific Cellular Immunity and Risk of Viral Reactivation Following Lung Transplantation: a Prospective Cohort Study
Mohammed Altaf et al., J Infect Dis. (2020) - PMID: 33274385 - Gating Harmonization Guidelines for Intracellular Cytokine Staining Validated in Second International Multiconsortia Proficiency Panel Conducted by Cancer Immunotherapy Consortium (CIC/CRI)
Leah S. Price et al., Journal of Quantitative Cell Science (2020) - PMID: 33090656 - Microwave Ablation Enhances Tumor‑Specific Immune Response In Patients With Hepatocellular Carcinoma
Katharina Leuchte et al., Cancer Immunology, Immunotherapy (2020) - PMID: 33006650 - A Glimpse Into the Diverse Cellular Immunity Against SARS-CoV-2
Lung-Ji Chang et al., Research Square (2020) - PMID: n.a. - Safety and Immunogenicity of a Modified Vaccinia Virus Ankara Vector Vaccine Candidate for Middle East Respiratory Syndrome: an Open-Label, Phase 1 Trial
Koch et al., Lancet (2020) - PMID: 32325037 - Concurrent Human Antibody and TH1 Type T-Cell Responses 2 Elicited by a COVID-19 RNA Vaccine
Sahin et al., medRXiv (2020) - Safety and Immunogenicity Of a Modified Vaccinia Virus Ankara Vector Vaccine Candidate For Middle East Respiratory Syndrome: An Open-Label, Phase 1 Trial
Till Koch et al., The Lancet Infectious Diseases (2020) - PMID: 32325037 - CMV-Reactive NK Cells in Pediatric Post-Hematopoietic Stem Cell Transplant
Nopporn Apiwattanakul et al., Transplantation Proceedings (2020) - PMID: 31870602 - Magnitude and Functional Profile of the Human CD4+ T Cell Response throughout Primary Immunization with Tick-Borne Encephalitis Virus Vaccine
Renata Varnaite et al., The Journal of Immunology (2020) - PMID: 31924650 - Antigen Responsive CD4+T Cell Clones Contribute to the HIV-1 Latent Reservoir
Pilar Mendoza et al., bioRxiv (2020) - PMID: n.a. - Immune Checkpoint Blockade Enhances Shared Neoantigen-Induced T-cell Immunity Directed against Mutated Calreticulin in Myeloproliferative Neoplasms
Cansu Cimen Bozkus et al., Cancer Discovery (2019) - PMID: 31266769 - Antigenspezifische T-Lymphozytenantworten als Immunmarker in Verschiedenen Varianten der Chronisch Inflammatorisch Demyelinsierenden Polyneuropathie
Jan Markus Diederich et al., Klinik für Neurologie mit Experimenteller Neurologie (2019) - PMID: n.a. - CD154‐Expressing CMV‐Specific T Cells Associate with Freedom from DNAemia and May be Protective in Seronegative Recipients After Liver or Intestine Transplantation
Chethan Ashokkumar et al., Wiley (2019) - PMID: n.a. - Extracellular pH Modulating Injectable Gel for Enhancing Immune Checkpoint Inhibitor Therapy
Hyung-seung Jin et al., Journal of Controlled Release (2019) - PMID: 31669264 - CD38 bright CD8+ T-cells Associated with the Development of Acute GVHD are Activated, Proliferating, and Cytotoxic Trafficking Cells
Pooja Khandelwal et al., Biology of Blood and Marrow Transplantation (2019) - PMID: 31442594 - Qualification of an IFN-g Elispot Assay in the Bioanalytical Laborator
W. Adamowicz et al., Poster#W1130-04-02 (2019) - PMID: n.a. - CNS Antigen-Specific B Cell and Antibody Assays in Multiple Sclerosis
Kuerten et al., United States Patent Application 20190072551 (2019) - PMID: n.a. - Leukoreduction System Chambers are a Reliable Cellular Source for the
Manufacturing of T‐Cell Therapeutics
Gabrielle Boudreau et al., Transfusion (2018) - PMID: 30589447 - Semi-Static Cell Culture
Molleryd et al., US Patent App. 15/574,003 (2018) - PMID: n.a. - Bi-Specific Targeted Chimeric Antigen Receptor T Cells
Wang et al., US Patent App. 15/561,921, 2018 (2018) - PMID: n.a. - Human Lymph Nodes Maintain TCF-1hi Memory T Cells with High Functional Potential and Clonal Diversity throughout Life
Miron et al., J Immunol (2018) - PMID: 30111633 - Reversibility of Peripheral Blood Leukocyte Phenotypic and Functional Changes after Exposure to and Withdrawal from Tofacitinib, a Janus Kinase Inhibitor, in Healthy Volunteers
Weinhold et al., Clin. Immunol (2018) - PMID: 29518577 - Human Cytomegalovirus-Specific Memory CD4+ T-cell Response and its Correlation with Virus Transmission to the Fetus in Pregnant Women with Primary Infection
Fornara et al., J Infect Dis. (2017) - PMID: 17330798 - The Effect of Genetic Variants Affecting NK Cell Function on Cardiovascular Health and the Burden on CMV
Waters S et al., Hum Immunol (2017) - PMID: 28987961 - Intradermal HIV-1 DNA Immunization Using Needle-free Zetajet TM Injection Followed by HIV-modified Vaccinia Virus Ankara Vaccination is Safe and Immunogenic in Mozambican Young Adults: a Phase I Randomized Controlled Trial
Viegas et al., AIDS Res Hum Retroviruses (2017) - PMID: 28969431 - CMV Drives the Expansion of Highly Functional Memory T Cells Expressing NK-Cell Receptors in Renal Transplant Recipients
Makwana et al., European Journal of Immunology (2017) - PMID: 28586095 - CMV Specific T-Cell Immunity in Solid Organ Transplant Recipients at Low Risk of CMV Infection. Chronology and Aplicability in Preemptive Therapy
Mena-Romo et al., Journal of Infection (2017) - PMID: 28599954 - Toll-Like Receptor 7 Agonist GS-9620 Induces HIV Expression and HIV-Specific Immunity in Cells from HIV-Infected Individuals on Suppressive Antiretroviral Therapy
Tsai et al., Journal of Virology (2017) - PMID: 28179531 - Generation of Dendritic Cell-based Vaccine Using High Hydrostatic Pressure for Non-small Cell Lung Cancer Immunotherapy
Hradilova et al., Plos One (2017) - PMID: 28187172 - Phase II Trial of Albumin-Bound Paclitaxel and Granulocyte Macrophage Colony-Stimulating Factor as an Immune Modulator in Recurrent Platinum Resistant Ovarian Cancer
Liaoa et al., Gynecologic Oncology (2017) - PMID: 28089377 - Phase I Trial of Recombinant Modified Vaccinia Ankara Encoding Epstein–Barr Viral Tumor Antigens in Nasopharyngeal Carcinoma Patients
Hui et al., Cancer Research (2016) - PMID: 23348421 - Individuals with Inherited Chromosomally Integrated Human Herpes Virus 6 (ciHHV-6) Have Functionally Active HHV-6 Specific T-cell Immunity
Strenger et al., Clinical Microbiology and Infection (2016) - PMID: 26482270 - Human Parainfluenza Virus-3 Can be Targeted by Rapidly Ex Vivo Expanded T Lymphocytes
McLaughlin et al., Cytotherapy (2016) - PMID: 27692559 - A Fully Human IgG1 Anti-PD-L1 MAb in an In Vitro Assay Enhances Antigen-Specific T-Cell Responses
Grenga et al., Clinical & Translational Immunology (2016) - PMID: n.a. - Efficacy and Safety of a Preemptive Antiviral Therapy Strategy Based on Combined Virological and Immunological Monitoring for Active Cytomegalovirus Infection in Allogeneic Stem Cell Transplant Recipients
Navarro et al., Oxford Jounals (2016) - PMID: n.a. - Stoke Induces Specific Alteration of T Memory Compartment Controlling Auto-Reactive CNS Antigen-Specific T Cell Responses
Klehmet et al., Journal of the Neurological (2016) - PMID: n.a. - Stabilization of Pre‐optimized Multicolor Antibody Cocktails for Flow Cytometry Applications
Chan et al., Cytometry Part B: Clinical Cytometry (2016) - PMID: 27001933 - How Frequently Are Predicted Peptides Actually Recognized by CD8 Cells?
Moldovan et al., Cancer Immunol Immunother. (2016) - PMID: 27108305 - RNA Vaccination Therapy: Advances in an Emerging Field
Thielemans et al., Journal of Immunology Research (2016) - PMID: n.a. - Impact of Persistent Cytomegalovirus Infection on Dynamic Changes in Human Immune System Profile
Vescovini et al., PlosOne - PMID: 26990192 - Standardization of Cryopreserved Peripheral Blood Mononuclear Cells Through a Resting Process for Clinical Immunomonitoring—Development of an Algorithm
Wang et al., Cytometry A. (2015) - PMID: 26848928 - Dichotomous Effects of Latent CMV Infection on the Phenotype and Functional Properties of CD8+ T-cells and NK-cells
Bigley et al., Cellular Immunology (2015) - PMID: n.a - Combined PI3K/Akt and Hsp90 Targeting Synergistically Suppresses Essential Functions of Alloreactive T Cells and Increases Tregs
Berges et al., J. Leukoc. Biol. (2015) - PMID: 26265781 - K562-Derived Whole-Cell Vaccine Enhances Antitumor Responses of CAR-Redirected Virus-Specific Cytotoxic T Lymphocytes In Vivo
Caruana et al., Clin Cancer Res. (2015) - PMID: 25691731 - Postdepletion Lymphocyte Reconstitution During Belatacept and Rapamycin Treatment in Kidney Transplant Recipients
Xu et al., Am J Transplant. (2015) - PMID: 26436448 - Latent CMV Infection in Rheumatoid Arthritis Increases Frequencies of cytolytic LIR‐1+ CD8+ T Cells
Rothe et al., Arthritis Rheumatol. (2015) - PMID: 26314621 - Self-adjuvanted mRNA Vaccination in Advanced Prostate Cancer Patients: a First-in-Man Phase I/IIa Study
Kübler et al., J Immunother Cancer. (2015) - PMID: 26082837 - Guidelines For the Automated Evaluation of Elispot Assays
Janetzki et al., Nature Protocols (2015) - PMID: 26110715 - The Transcriptional PPARβ/ Network in Human Macrophages Defines a Unique Agonist-induced Activation State
Adhikary et al., Nucleic Acids Res.(2015) - PMID: 25934804 - Development of a Novel IGRA Assay to Test T Cell Responsiveness to HBV Antigens in Whole Blood of Chronic Hepatitis B Patients
Dammermann et al., J Transl Med. (2015) - PMID: 25968473 - Profiling T Cell Activation Using Single-Molecule Fluorescence In Situ Hybridization and Flow Cytometry
Bushkin et al., J. Immunol. (2015) - PMID: 25505292 - Identification and HLA-Tetramer-Validation of Human [CD4.sup.+] and [CD8.sup.+] T Cell Responses Against HCMV Proteins IE1 and IE2
Peter Braendstrup et al., PLoS ONE (2014) - PMID: 24760079 - Cognate CD4 T-Cell Licensing of Dendritic Cells Heralds Anti-CMV CD8 T-Cell Immunity After Human Allogeneic Umbilical Cord Blood Transplantation
Flinsenberg et al., J Virol. (2014) - PMID: 25378489 - T-bet:Eomes Balance, Effector Function, and Proliferation of Cytomegalovirus-specific CD8+ T Cells During Primary Infection Differentiates the Capacity for Durable Immune Control
Popescu et al., J Immunol. (2014) - PMID: 25339676 - Polyfunctional Analysis of Human Cytomegalovirus (HCMV)-Specific CD4+ and CD8+ Memory T-Cells in HCMV-Seropositive Healthy Subjects Following Different Stimuli
Gabanti et al., J Clin Immunol. (2014) - PMID: 25231588 - Toward Development of a Comprehensive External Quality Assurance Program for Polyfunctional Intracellular Cytokine Staining Assays
Staats et al., J Immunol Methods. (2014) - PMID: 24968072 - Viral Load, CMV-Specific T Cell Immune Response and Cytomegalovirus Disease in Solid Organ Transplant Recipients at Higher Risk for Cytomegalovirus Infection During Preemptive Therapy
Martín-Gandul et al., Transpl Int. (2014) - PMID: 24964364 - A Registry of HLA-Typed Donors for Production of Virus-Specific CD4 and CD8 T Lymphocytes for Adoptive Reconstitution of Immune-compromised Patients
Pira et al., Transfusion. (2014) - PMID: 25041366 - Frequent Occurrence of Cytomegalovirus Retinitis During Immune Reconstitution Warrants Regular Ophthalmic Screening in High-Risk Pediatric Allogeneic Hematopoietic Stem Cell Transplant Recipients
Hiwarkar et al., Clinical Infectious Diseases (2014) - PMID: 24700657 - Increased Inflammatory Response in Cytomegalovirus Seropositive Patients with Alzheimer's Disease
Westmann et al., Plos One (2014) - PMID: 24804776 - Identification and HLA-Tetramer-Validation of Human CD4+ and CD8+ T Cell Responses Against HCMV Proteins IE1 and IE2
Braendstrup et al., PLOS ONE (2014) - PMID: 24760079 - Timing and Intensity of Exposure to Interferon‐gamma Critically Determines the Function of Monocyte‐derived Dendritic Cells
Kerkar et al., Immunology (2014) - PMID: 24678989 - Day 3 Poly (I: C)-Activated Dendritic Cells Generated in CellGro for Use in Cancer Immunotherapy Trials are Fully Comparable to Standard Day 5 DCs
Truxova et al., Immunology Letters (2014) - PMID: 24726860 - Immunologic Response to the Survivin-Derived Multi-Epitope Vaccine EMD640744 in Patients with Advanced Solid Tumors
Lennerz er al., Cancer Immunol Immunothert (2014) - PMID: 24487961 - Miniaturized and High Throughput Assays for Analysis of T-Cell Responses Specific for Opportunistic Pathogens and HIV
Li Pira et al., Clin Vaccine Immunol. (2014) - PMID: 24477854 - The Allo- and Viral-Specific Immunosuppressive Effect of Belatacept, but Not Tacrolimus, Attenuates with Progressive T Cell Maturation
Xu er al., Am. J. Transplant (2014) - PMID: 24472192 - Statistical Methods for the Assessment of EQAPOL Proficiency Testing: ELISpot, Luminex, and Flow Cytometry
Rountree et al., J. Immunol Methods (2014) - PMID: 24456626 - Evaluation of Cytomegalovirus (CMV)-Specific T-Cell Immunity for the Assessment of the Risk of Active CMV Infection in Non-Immunosuppressed Surgical and Trauma Intensive Care Unit Patients
Clari et al., J. Med Virol. (2013) - PMID: 23868746 - Immunotherapeutic Strategies to Prevent and Treat Human Herpesvirus 6 Reactivation after Allogeneic Stem Cell Transplantation
Gerdemann et al. (2013) - PMID: 23152545 - Lymphocyte Activation Gene-3 Expression Defines a Discrete Subset of HIV-Specific CD8+ T Cells That Is Associated with Lower Viral Load
Peña et al., AIDS Res Hum Retroviruses (2013) - PMID: 24180338 - Cytomegalovirus-Specific Cytotoxic T Lymphocytes Can Be Efficiently Expanded from Granulocyte Colony-Stimulating Factor–Mobilized Hemopoietic Progenitor Cell Products Ex Vivo and Safely Transferred to Stem Cell Transplantation Recipients to Facilitate Imm
Clancy et al., Biology Blood Marrow Transplant (2013) - PMID: 23380344 - Broad and Potent Cellular and Humoral Immune Responses After a Second Late HIV-Modified Vaccinia Virus Ankara Vaccination in HIV-DNA-Primed and HIV-Modified Vaccinia Virus Ankara-Boosted Swedish Vaccinees
Nilsson et al., AIDS Res Hum Retroviruses (2013) - PMID: 24090081 - Combining Next-Generation Sequencing and Immune Assays: A Novel Method for Identification of Antigen-Specific T Cells
Klinger et al., PLoS One (2013) - PMID: 24069285 - Single-Cell Level Response of HIV-Specific and Cytomegalovirus-Specific CD4 T Cells Correlate With Viral Control in Chronic HIV-1 Subtype A Infection
Eller et al., J. Acquir Immune Defic Syndr (2012) - PMID: 22580564 - A New Antigen Scanning Strategy for Monitoring HIV-1 Specific T-cell Immune Responses
Manati et al., Journal of Immunological Methods (2012) - PMID: 21963950 - Polyfunctional T Cells Accumulate in Large Human Cytomegalovirus-Specific T Cell Responses
Lachmann et al., J. Virol. (2012) - PMID: 22072753 - Innate and Adaptive Immune Responses Both Contribute to Pathological CD4 T Cell Activation in HIV-1 Infected Ugandans
Eller et al., PLoS ONE (2011) - PMID: 21526194 - Correlating Cellular and Molecular Signatures of Mucosal Immunity that Distinguish HIV Controllers from Non-Controllers
Loke et al., Blood (2011) - PMID: 20160163 - Generation of a Multipathogen-Specific T-cell Product for Adoptive Immunotherapy Based on Activation-Dependent Expression of CD154
Khanna et al., Blood (2011) - PMID: 21642594 - A Panel of Human Cell-Based Artificial APC Enables the Expansion of Long-Lived Antigen-Specific CD4+ T Cells Restricted by Prevalent HLA-DR Alleles
Butler et al., Int. Immunol. (2010) - PMID: 21059769 - AdCD40L Immunogene Therapy for Bladder Carcinoma—The First Phase I/IIa Trial
Malmström et al., Clin. Cancer Res. (2010) - PMID: 20448220 - Intense Antiextracellular Adaptive Immune Response to Human Cytomegalovirus in Very Old Subjects with Impaired Health and Cognitive and Functional Status
Vescovini et al., J. Immunol. (2010) - PMID: 20173031 - Human Late Memory CD8+ T Cells Have a Distinct Cytokine Signature Characterized by CC Chemokine Production without IL-2 Production
St. Johns et al., J. Immunol. (2009) - PMID: 19841187 - The Transfer of Adaptive Immunity to Cytomegalovirus (CMV) During Hematopoietic Stem Cell Transplantation is Dependent on the Specificity and Phenotype of CMV-Specific T Cells in the Donor
Scheinberg et al., Blood (2009) - PMID: 19776383 - T Cell Infiltrates in the Muscles of Patients with Dermatomyositis and Polymyositis Are Dominated by CD28null T Cells
Fasth et al., J. Immunol. (2009) - PMID: 19752224 - Identification and Characterization of IL-10/IFN-gamma-Producing Effector-Like T cells with Regulatory Function in Human Blood
Haringer et al., J. Exp. Med. (2009) - PMID: 19414553 - Enumeration of Cytomegalovirus-Specific Interfering CD8+ and CD4+ T Cells Early After Allogeneic Stem Cell Transplantation May Identify Patients at Risk of Active Cytomegalovirus Infection
Solano et al., Haematologica (2008) - PMID: 18603553 - Clonotype Analysis of Cytomegalovirus-Specific Cytotoxic T Lymphocytes
Babel et al., JASN Express (2008) - PMID: 18799721 - Type I IFN-Induced, NKT Cell-Mediated Negative Control of CD8 T Cell Priming by Dendritic Cells1
Bochtler et al., The Journal of Immunology (2008) - PMID: 18641299 - Prophylactic Infusion of Cytomegalovirus Specific Cytotoxic T-lymphocytes Stimulated with Ad5f35pp65 Gene Modified Dendritic Cells Following Allogeneic Haemopoietic Stem Cell Transplantation
Micklethwaite et al., Blood (2008) - PMID: 18768783 - Massive Load of Functional Effector CD4+ and CD8+ T Cells against Cytomegalovirus in Very Old Subjects
Viscovini et al., J Immunol. (2007) - PMID: 17785869 - Longitudinal Assessment of Cytomegalovirus (CMV)–Specific Immune Responses in Liver Transplant Recipients at High Risk for Late CMV disease
La Rosa et al., The Journal of Infectious Diseases (2007) - PMID: 17262704 - No Evidence for Circulating HuD-Specific CD8+ T Cells in Patients with Paraneoplastic Neurological Syndromes and Hu Antibodies
De Beukelaar et al., Cancer Immunol Immunother (2007) - PMID: 17597332 - The T Cell Response to Persistent Herpes Virus Infections in Common Variable Immunodeficiency
Raeiszadeh et al., British Society for Immunology, Clinical and Experimental Immunology (2006) - PMID: 17034575 - Monoculture-Derived T lymphocytes Specific for Multiple Viruses Expand and Produce Clinically Relevant Effects in Immunocompromised Individuals
Leen et al., Nature Medicine (2006) - PMID: 16998485 - Direct Access to CD4+ T Cells Specific for Defined Antigens According to CD154 Expression
Frentsch et al., Nat Med. (2005) - PMID: 16186818 - HLA Type-Independent Generation of Antigen-Specific T Cells for Adoptive Immunotherapy
Hammer et al., Eur. J. Immunol. (2005) - PMID: 16468975
Loading...