
S26C-Beta-Amyloid (1-40) Dimer HFIP treated



Product Description

Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein (Swiss-Prot ID: P05067). HFIP treatment is performed to disrupt beta-sheets and other unwanted secondary structures.
Amino Acid Sequence: [DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV]2; dimerized via S-S brigde (Cys26)
Protein Name: Amyloid beta (A4) (alternative names: Abeta, Beta amyloid, APP)
Purity: >95% (HPLC-MS)
Delivery Format: Freeze-dried in plastic vial
Indication(s)/Topic(s): Alzheimer's disease
Delivery Time: 2-5 days

JPT's Single Catalog Peptides
JPT Peptide Technologies has substantial, long-standing expertise in providing peptides, peptidomimetics, and proteins to the global scientific community. Our highly skilled and committed scientific staff ensures that the most appropriate methods and techniques are selected for every synthesis project. All of JPT's catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

Benefits of JPT's Single Catalog Peptides
- Whole production performed in a regulated European environment according to DIN EN ISO 9001:2015 & GCLP standards; audits welcome!
- Synthesis protocols designed to avoid toxic contaminants and side products
- Provision of freeze dried aliquots for enhanced stability
- Proven track record for applications in clinical studies


References for S26C-Beta-Amyloid (1-40) Dimer HFIP treated

Read References with Amyloid Beta A4 Peptides (abeta, aß)

Application Note
Synthetic Amyloid Beta Peptides Aid Alzheimer Investigation
Broersen et al., Application Note (2013) (full text)

"Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source. We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle."
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands


Documentation for S26C-Beta-Amyloid (1-40) Dimer HFIP treated


Properties of S26C-Beta-Amyloid (1-40) Dimer HFIP treated

Properties Values
Category: Abeta & Prion Peptides
Indication / Topic: Alzheimer's disease
Organism: Homo sapiens (Human)
Protein Name: Amyloid beta (A4) protein

Further Information to S26C-Beta-Amyloid (1-40) Dimer HFIP treated

Information Values
Specifications: Point mutated synthetic Beta-Amyloid peptide (1-40)
TÜV Rheinland certified
Health - made in Germany
Quality Assurance

All production is performed according to ISO 9001:2015 standards.

Check our list of products, click and go.

Get a quote