







PepStar™ SARS (E protein)
Description
Product Description
Peptide microarray displaying 17 peptides derived from a peptide scan (15mers with 11 aa overlap) through E protein (Swiss-Prot ID: P59637) of SARS-CoV (Severe acute respiratory syndrome coronavirus).
Amount: 1 microarray (1" x 3")
Delivery Format: 21-sample peptide microarray
Application(s): Antibody epitope discovery, Immune monitoring
Indication(s)/Topic(s): Respiratory infection, Severe acute respiratory syndrome (SARS), Covid-19
Delivery Time: approx. 10 days
PepStar™ Peptide Microarrays
JPT Peptide Technologies applies its unique peptide microarray platform to generate peptide microarrays on glass slides for biomarker discovery, immunomonitoring and detection and validation of protein interactions. Peptides are immobilized on glass slides via a flexible linker by chemoselective coupling. The covalently attached peptides are displayed infour copies on each slide. In addition, multiple identical copies of each microarray are produced. Incubation can be performed manually or automated using only minimal amounts of your sample. Read-out via fluorescence results in low background and high sensitivity.
Benefits of JPT's PepStar™ Peptide Microarrays
- Get hundreds of identical microarray copies
- Peptides are free of truncated sequences
- Small amounts of your precious samples are needed for incubation
- Applicable to a variety of biological samples (e.g. serum, plasma, antibody)
- Low background on glass surface
- Read-out via fluorescence
References
References for PepStar™ SARS (E protein)
References:
Read References with PepStar™ Peptide Microarrays
Application Notes
A Modular Approach for Epitope Discovery and High-Resolution Profiling of Humoral Immune Responses
Pawlowski et al. (2013) Full text
Multiple Sclerosis and Epstein Barr Virus Infection. An Epitope Mapping Study
Reimer et al. (2014) Full text
The Challenge of Antigen Sequence Diversity:Solutions with ULTRA Peptide Libraries
Pawlowski et al. (2015) Full text
Rapid Mimotope Optimization for Pharmacokinetic Analysis of the Novel Therapeutic antibody IMAB362
Daneschar et al. (2014) Full text
Testimonials for JPT's Peptide Microarrays
"Over the past five years my research team has been active in the development of species-specific peptide arrays. Our ability to advance this technology into new research areas has been dependent on working with the highest quality of arrays. In this regard, JPT's commitment to excellence has been a critical foundation for the success of our research program. I have been consistently impressed with their customer service, technical expertise and professionalism. When it comes to peptide work there are no other options for our group, JPT is the best."
Scott Napper, PhD, Vaccine and Infectious Disease Organization (VIDO), University of Saskatchewan, Canada
"The RV 144 HIV trial is considered as one of first successful HIV vaccine trials. It has become clear that the V2 loop of gp120 is an important site for immunogenicity and protection from HIV infection. The use of JPT's PepStar™ microarray technology has been very useful for the correlation of the clincial outcome with humoral immune responses. As have the cyclic peptides been from JPT to validate these findings!."
Jeff Currier, PhD, Walter Reed Army Institute, Rockville, Maryland, USA
"We study modulation of dopaminergic neurotransmisson by TAAR1 and D2R. The functional interaction of the two receptors in the brain supports TAAR1 as a target for the treatment of psychiatric disorders such as schizophrenia or bipolar disorder. To map the epitopes of our newly generated specific anti-rat TAAR1 antibodies we used JPT's PepStarTM peptide microarrays. The peptide microarrays greatly contributed to our successful and recently published study. We were very satisified with the exceptional product and service delivered by JPT Peptide Technologies as well as their scientific Customer Support which was always at our disposal."
Stefan Obermüller, F.Hoffmann - La Roche Ltd., Roche Pharma Research and Early Development, Basel, Switzerland
Documentation
Documentation for PepStar™ SARS (E protein)
Properties
Properties of PepStar™ SARS (E protein)
Properties | Values |
---|---|
Application: | Antibody epitope discovery, Immune monitoring |
Category: | PepStar Peptide Microarrays |
Indication / Topic: | Covid-19, Respiratory infection, Severe acute respiratory syndrome (SARS) |
Organism: | SARS-CoV (Severe acute respiratory syndrome coronavirus) |
Protein Name: | E protein |
Further Information to PepStar™ SARS (E protein)
Information | Values |
---|---|
Sequence: | MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV |
Specifications: | Peptide scan (15mers with 11 aa overlap) |


Quality Assurance
All production is performed according to ISO 9001:2015 standards.