Skip to main content Skip to search Skip to main navigation

About PepStar™ Influenza A (MP1 (H3N2))

Peptide microarray displaying 61 peptides derived from a peptide scan (15mers with 11 aa overlap) through Matrix proteins (Swiss-Prot ID: Q67157) of Influenza A.

PepStar™ Influenza A (MP1 (H3N2)) - Specifications

  • Amount: 1 microarray (1" x 3")
  • Delivery Format: 1-sample peptide microarray
  • Application(s): B-cell immunity
  • Condition(s)/Topic(s): Influenza, Respiratory infection, Flu-like disease
  • Standard Delivery Time: approx. 3 weeks

Visit our webpage for more Peptide Tools to Study Influenza

Are you interested in your custom Peptide Microarrays? Choose your sequences, and array format. We will assist you along the way. Custom PepStar Peptide Microarrays.

PepStar™ Peptide Microarrays
JPT Peptide Technologies applies its unique peptide microarray platform to generate peptide microarrays on glass slides for biomarker discovery, immunomonitoring and detection and validation of protein interactions. Peptides are immobilized on glass slides via a flexible linker by chemoselective coupling. The covalently attached peptides are displayed infour copies on each slide. In addition, multiple identical copies of each microarray are produced. Incubation can be performed manually or automated using only minimal amounts of your sample. Read-out via fluorescence results in low background and high sensitivity.

Benefits of JPT's PepStar™ Peptide Microarrays
- Get hundreds of identical microarray copies
- Peptides are free of truncated sequences
- Small amounts of your precious samples are needed for incubation
- Applicable to a variety of biological samples (e.g. serum, plasma, antibody)
- Low background on glass surface
- Read-out via fluorescence

References for PepStar™ Influenza A (MP1 (H3N2))

References:
Read References with PepStar™ Peptide Microarrays

Application Notes
A Modular Approach for Epitope Discovery and High-Resolution Profiling of Humoral Immune Responses
Pawlowski et al. (2013) Full text
Multiple Sclerosis and Epstein Barr Virus Infection. An Epitope Mapping Study
Reimer et al. (2014) Full text
The Challenge of Antigen Sequence Diversity:Solutions with ULTRA Peptide Libraries
Pawlowski et al. (2015) Full text
Rapid Mimotope Optimization for Pharmacokinetic Analysis of the Novel Therapeutic antibody IMAB362
Daneschar et al. (2014) Full text

Testimonials for JPT's Peptide Microarrays
"We at CNAM have studied the immune response of infected or control patients (Covid-19, asymptomatic, or pre-epidemic sera) by epitope mapping against peptides derived from the structural peptides of SARs-CoV-2. For our antibody mapping studies we have used the JPT's PepStar peptide microarrays and their comprehensive microarray profiling services. PepStar peptide microarrays with their very high quality and batch-to-batch reproducibility in combination with easy read-out and JPT’s personalized customer support have provided excellent results. We are very pleased to have worked with the JPT technology and plan to work again with them in the future.."
Prof. Jean-Francois Zagury, Conservatoire National des Arts et Métiers, Paris, France

"We utilize JPT's multiwell microarray assay service to study autoimmune diseases such as rheumatoid arthritis. Our laboratory focuses on the mechanisms by which rheumatoid arthritis-associated HLA-DR molecules contribute to the development of anti-citrullinated protein antibodies (ACPAs) in rheumatoid arthritis. We have developed a sensitive peptide array assay, capable to detect and monitor ACPAs in mice (Front Immunol, 2022). JPT’s multiwell microarray assay service based on their PepStar peptide microarrays has been a most reliable and robust approach for our experiments. Their full profiling and data interpretation service with its excellent documentation has helped to further our research of rheumatoid arthritis.."
Dr. Isabelle Auger, INSERM UMRs 1097, Marseille, France

"We study modulation of dopaminergic neurotransmisson by TAAR1 and D2R. The functional interaction of the two receptors in the brain supports TAAR1 as a target for the treatment of psychiatric disorders such as schizophrenia or bipolar disorder. To map the epitopes of our newly generated specific anti-rat TAAR1 antibodies we used JPT's PepStarTM peptide microarrays. The peptide microarrays greatly contributed to our successful and recently published study. We were very satisified with the exceptional product and service delivered by JPT Peptide Technologies as well as their scientific Customer Support which was always at our disposal."
Stefan Obermüller, F.Hoffmann - La Roche Ltd., Roche Pharma Research and Early Development, Basel, Switzerland

Documentation for PepStar™ Influenza A (MP1 (H3N2))

Properties of PepStar™ Influenza A (MP1 (H3N2))

Amount: 1 microarray (1" x 3")
Application: B-cell Immunity
Category: PepStar Peptide Microarrays
Condition / Topic: Flu-like disease, Influenza, Respiratory infection
Layout: 21-sample peptide microarray
Organism: Influenza A
Protein Name: Matrix proteins
Quantification: No

Further Information to PepStar™ Influenza A (MP1 (H3N2))

Information Values
Sequence:
MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTCPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRAIGTHPRSSAGLKDDLLENLQAYQKRMGVQMQRFK
Specifications: Peptide scan (15mers with 11 aa overlap)
Loading...

Check our list of products, click and go.

Get a quote