RT-MOG-2

PepStar™ Human (MOG)

US$1,027.00

Excluding tax and shipping fees

In stock

Description

About PepStar™ Human (MOG)

The PepStar™ Human MOG peptide microarray displays 59 overlapping peptides spanning the 247-amino-acid human myelin oligodendrocyte glycoprotein sequence (UniProt Q16653). The 15mer scan with an 11-amino-acid overlap supports MOG epitope mapping and antibody profiling by measuring binding to individual peptide features. RT-MOG-2 is the 21-sample microarray variant, allowing multiple samples to be assessed against the same peptide panel.

Peptide microarray displaying 59 peptides derived from a peptide scan (15mers with 11 aa overlap) through Myelin-oligodendrocyte glycoprotein (Swiss-Prot ID: Q16653) of Human.

PepStar™ Human (MOG) - Specifications

Amount: 1 microarray (1" x 3")
Delivery Format: 21-sample peptide microarray
Application(s): B-cell immunity, Cancer biomarker research
Condition(s)/Topic(s): Control
Standard Delivery Time: approx. 3 weeks

Applications

Mapping antibody-binding regions through overlapping human MOG peptides.
MOG B-cell epitope mapping focused on linear peptide determinants.
Comparison of peptide-specific antibody-binding profiles in serum, plasma or antibody samples.
Fluorescence-based analysis of binding to individual MOG peptide features.

MOG Peptide Array for Antibody Profiling

Within JPT’s PepStar™ Peptide Microarrays, this human MOG peptide array provides sequence-resolved binding measurements for humoral immune research. Linear peptide features help localize recognized regions, while antibodies requiring the folded protein’s conformation may not be detected. See the MOG product overview for other research formats.

Peptide-Resolved Binding Across 59 MOG Sequences

Separate peptide features let researchers associate a binding signal with a defined region of the scanned sequence. The overlapping design helps narrow candidate recognition regions, and the 21-sample format supports comparisons on a common peptide panel. Fluorescence readout provides a binding profile for subsequent investigation.

Want to investigate an individual candidate sequence?
Request peptides for follow-up research through Custom Peptide Synthesis.

References

References for PepStar™ Human (MOG)

References:
Read References with PepStar™ Peptide Microarrays

Application Notes
A Modular Approach for Epitope Discovery and High-Resolution Profiling of Humoral Immune Responses
Pawlowski et al. (2013) Full text
Multiple Sclerosis and Epstein Barr Virus Infection. An Epitope Mapping Study
Reimer et al. (2014) Full text
The Challenge of Antigen Sequence Diversity:Solutions with ULTRA Peptide Libraries
Pawlowski et al. (2015) Full text
Rapid Mimotope Optimization for Pharmacokinetic Analysis of the Novel Therapeutic antibody IMAB362
Daneschar et al. (2014) Full text

Testimonials for JPT's Peptide Microarrays
"We at CNAM have studied the immune response of infected or control patients (Covid-19, asymptomatic, or pre-epidemic sera) by epitope mapping against peptides derived from the structural peptides of SARs-CoV-2. For our antibody mapping studies we have used the JPT's PepStar peptide microarrays and their comprehensive microarray profiling services. PepStar peptide microarrays with their very high quality and batch-to-batch reproducibility in combination with easy read-out and JPT’s personalized customer support have provided excellent results. We are very pleased to have worked with the JPT technology and plan to work again with them in the future.."
Prof. Jean-Francois Zagury, Conservatoire National des Arts et Métiers, Paris, France

"We utilize JPT's multiwell microarray assay service to study autoimmune diseases such as rheumatoid arthritis. Our laboratory focuses on the mechanisms by which rheumatoid arthritis-associated HLA-DR molecules contribute to the development of anti-citrullinated protein antibodies (ACPAs) in rheumatoid arthritis. We have developed a sensitive peptide array assay, capable to detect and monitor ACPAs in mice (Front Immunol, 2022). JPT’s multiwell microarray assay service based on their PepStar peptide microarrays has been a most reliable and robust approach for our experiments. Their full profiling and data interpretation service with its excellent documentation has helped to further our research of rheumatoid arthritis.."
Dr. Isabelle Auger, INSERM UMRs 1097, Marseille, France

"We study modulation of dopaminergic neurotransmisson by TAAR1 and D2R. The functional interaction of the two receptors in the brain supports TAAR1 as a target for the treatment of psychiatric disorders such as schizophrenia or bipolar disorder. To map the epitopes of our newly generated specific anti-rat TAAR1 antibodies we used JPT's PepStarTM peptide microarrays. The peptide microarrays greatly contributed to our successful and recently published study. We were very satisified with the exceptional product and service delivered by JPT Peptide Technologies as well as their scientific Customer Support which was always at our disposal."
Stefan Obermüller, F.Hoffmann - La Roche Ltd., Roche Pharma Research and Early Development, Basel, Switzerland

Documentation

Documentation for PepStar™ Human (MOG)

Properties

Properties of PepStar™ Human (MOG)

Amount:	1 microarray (1" x 3")
Application:	B-cell Immunity, Cancer biomarker research
Category:	PepStar Peptide Microarrays
Condition / Topic:	Control
Layout:	21-sample peptide microarray
Organism:	Human
Protein Name:	Glycoprotein, Myelin-oligodendrocyte glycoprotein
Quantification:	No

Further Information to PepStar™ Human (MOG)

Information	Values
Sequence:	MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Specifications:	Peptide scan (15mers with 11 aa overlap)