PM-SARS2-RBDMUT05-1

PepMix™ SARS-CoV-2 (S-RBD B.1.617.1 / Kappa)

US$454.00

Description

Product Description

Pool of 53 peptides derived from a peptide scan (Peptide scan (15mers with 11 aa overlap)) through Receptor Binding Domain of Spike Glycoprotein - Kappa Variant of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) - (Lineage B.1.617.1, Kappa Variant).

Amount: 25 ug (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)
Purity: crude (major peak by LC-MS is guaranteed to be peptide of interest for each peptide)
Delivery Format: Freeze-dried in glass vial
Application(s): Antigen specific T-cell stimulation, Cellular immune response, Immune monitoring, T-cell assays, T-cell expansion
Indication(s)/Topic(s): Covid-19
Delivery Time: 2-5 days

PepMix™ Peptide Pools
Protein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for
- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, cytokine staining, cell-mediated cytotoxicity or proliferation assays)
- In-vitro T cell expansion
- Dendritic cell pulsing
- Immune monitoring
- Cellular immune response profiling
- T cell epitope identification
- Standardization of T cell assays

Benefits of PepMix™
- Produced under stringent ISO 9001 regulations
- Each peptide quality controlled and guaranteed for identity and purity
- CoA and HPLC-MS data available for each individual peptide batch
- High batch-to-batch consistency
- No false positive T cell responses by contaminating deletion peptides
- No toxic inhibition of T cell responses due to stringent purification of each peptide
- Minimization of endotoxin contamination due to low bioburden process
- ADCF policy in place
- HLA independent stimulation (only for antigen spanning peptide pools)

References

References for PepMix™ SARS-CoV-2 (S-RBD B.1.617.1 / Kappa)

References
Read References with
PepMix™ Peptide Pools for Infectious Diseases
COVID-19 related PepMixes™
PepMix™ Control Pools

Application Notes
Peptide Tools to Support the Fight against COVID-19
Alem et al (2020) Full text
Developing Multi-HIV Antigen Specific T-Cells as a Component of a Cure Strategy
Lam et al. (2015) Full text
Peptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell Transplantation
Gary et al. (2015) Full text

Testimonials
"To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our go-to company for purchasing peptides."
Dr. Laura J Pallett, Infection and Immunity, University College London, UK

Documentation

Documentation for PepMix™ SARS-CoV-2 (S-RBD B.1.617.1 / Kappa)

Properties

Properties of PepMix™ SARS-CoV-2 (S-RBD B.1.617.1 / Kappa)

Properties Values
Application: Antigen specific T-cell stimulation, Cellular immune response, Immune monitoring, T-cell assays, T-cell expansion
Category: PepMix Peptide Pools
Indication / Topic: Covid-19
Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2)
Protein Name: Receptor Binding Domain of Spike Glycoprotein

Further Information to PepMix™ SARS-CoV-2 (S-RBD B.1.617.1 / Kappa)

Information Values
Sequence:
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSTPCNGVQGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Specifications: Peptide scan (15mers with 11 aa overlap)
Loading...
TÜV Rheinland certified
Health - made in Germany
Quality Assurance

All production is performed according to ISO 9001:2015 standards.

Check our list of products, click and go.

Get a quote