PepMix™ M. tuberculosis (ACR)
Description
About PepMix™ M. tuberculosis (ACR)
Pool of 34 peptides derived from a peptide scan (15mers with 11 aa overlap) through Alpha-crystallin (Swiss-Prot ID: P9WMK1) of M. Tuberculosis - strain ATCC 25618 / H37Rv.
PepMix™ M. tuberculosis (ACR) - Specifications
Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)Purity: Development Grade: each peptide purified to > 70% (HPLC/MS)
(equivalent to an average purity of 85%)
Delivery Format: Freeze-dried in glass vial
Application(s): T-cell Immunity, Cancer biomarker research
Condition(s)/Topic(s): Opportunistic infections, Respiratory infection, Tuberculosis, Infection
Standard Delivery Time: 2-5 daysVisit our overview page for more information on Tuberculosis and Tropical Diseases.
Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.
PepMix™ Peptide Pools
Protein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for
- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)
- In-vitro T cell expansion
- Dendritic cell pulsing
- Immune monitoring
- Cellular immune response profiling
- T cell epitope identification
- Standardization of T cell assays
Benefits of PepMix™
- Production ISO 9001 certified
- Each peptide quality controlled and guaranteed for identity and purity
- CoA and HPLC-MS data available
- High batch-to-batch consistency
- No false positive T cell responses by contaminating deletion peptides
- No toxic inhibition of T cell responses due to stringent purification of each peptide
- Minimization of endotoxin contamination due to low bioburden process
- ADCF policy in place
- HLA independent stimulation (with antigen spanning peptide pools)
References
References for PepMix™ M. tuberculosis (ACR)
References
Read References with
PepMix™ Peptide Pools for Infectious Diseases
COVID-19 related PepMixes™
PepMix™ Control Pools
Application Notes
Peptide Tools to Support the Fight against COVID-19
Alem et al (2020) Full text
Developing Multi-HIV Antigen Specific T-Cells as a Component of a Cure Strategy
Lam et al. (2015) Full text
Peptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell Transplantation
Gary et al. (2015) Full text
Testimonials
"To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our go-to company for purchasing peptides."
Dr. Laura J Pallett, Infection and Immunity, University College London, UK
Documentation
Documentation for PepMix™ M. tuberculosis (ACR)
Properties
Properties of PepMix™ M. tuberculosis (ACR)
Properties | Values |
---|---|
Amount: | 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) |
Application: | Cancer biomarker research, T-cell immunity |
Category: | PepMix Peptide Pools, PepMix Peptide Pools Infections |
Condition / Topic: | Infection, Opportunistic infections, Respiratory infection, Tuberculosis |
Layout: | Freeze-dried in glass vial |
Organism: | M. tuberculosis |
Protein Name: | Alpha-crystallin |
Purity: | >70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS) |
Quantification: | Yes |
Further Information to PepMix™ M. tuberculosis (ACR)
Information | Values |
---|---|
Sequence: |
MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
|
Specifications: | Peptide scan (15mers with 11 aa overlap) |
Quality Assurance
All production is ISO 9001:2015 certified.