PM-PSCA
Pool of 26 peptides derived from a peptide scan through Prostate stem cell antigen (Swiss-Prot ID: O43653) of Human.
Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.
PepMix™ Peptide Pools
Protein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for
- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)
- In-vitro T cell expansion
- Dendritic cell pulsing
- Immune monitoring
- Cellular immune response profiling
- T cell epitope identification
- Standardization of T cell assays
Benefits of PepMix™
- Each peptide quality controlled and guaranteed for identity and purity
- CoA and HPLC-MS data available
- High batch-to-batch consistency
- No false positive T cell responses by contaminating deletion peptides
- No toxic inhibition of T cell responses due to stringent purification of each peptide
- Minimization of endotoxin contamination due to low bioburden process
- ADCF policy in place
- HLA independent stimulation (with antigen spanning peptide pools)
References
Read References with
PepMix™ Peptide Pools for Tumor Associated Antigens
PepMix™ Control Pools
Application Notes
Cross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccination
Loyal et al (2021) Full text
Peptide Tools to Support the Fight against COVID-19
Alem et al (2020) Full text
CEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverage
Eckey et al. (2017) Full text
Developing Multi-HIV Antigen Specific T-Cells as a Component of a Cure Strategy
Lam et al. (2015) Full text
Peptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell Transplantation
Gary et al. (2015) Full text
PepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell Transplant
Keirnan et al. (2012) Full text
Cytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging Population
Kern (2012) Full text
| Properties | Values |
|---|---|
| Amount: | 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) |
| Application: | T-cell immunity |
| Category: | PepMix Peptide Pools |
| Condition / Topic: | Prostate cancer |
| Layout: | Freeze-dried in glass vial |
| Organism: | Human |
| Protein Name: | Prostate stem cell antigen |
| Purity: | Development Grade: each peptide purified to > 70% (HPLC/MS) |
| Quantification: | No |
| Information | Values |
|---|---|
| Sequence: |
MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
|
| Specifications: | 15mers with 11 aa overlap |
Check our list of products, click and go.
Get a quote