.jpg "PepMix™ Human (Myeloblastin)")
PM-PRTN3
Pool of 62 peptides derived from a peptide scan (15mers with 11aa overlap) through Myeloblastin (PRTN3) (Swiss-Prot ID: P24158) of Human.
PepMix™ Peptide Pools
Protein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for
- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)
- In-vitro T cell expansion
- Dendritic cell pulsing
- Immune monitoring
- Cellular immune response profiling
- T cell epitope identification
- Standardization of T cell assays
Benefits of PepMix™
- Each peptide quality controlled and guaranteed for identity and purity
- CoA and HPLC-MS data available
- High batch-to-batch consistency
- No false positive T cell responses by contaminating deletion peptides
- No toxic inhibition of T cell responses due to stringent purification of each peptide
- Minimization of endotoxin contamination due to low bioburden process
- ADCF policy in place
- HLA independent stimulation (with antigen spanning peptide pools)
References
Read References with
PepMix™ Peptide Pools for Infectious Diseases
PepMix™ Control Pools
Testimonials
"To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our go-to company for purchasing peptides."
Dr. Laura J Pallett, Infection and Immunity, University College London, UK
| Properties | Values |
|---|---|
| Amount: | 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) |
| Application: | T-cell immunity |
| Category: | PepMix Peptide Pools |
| Condition / Topic: | Autoimmune disease, Granulomatosis, Inflammation, Wegener's Disease |
| Layout: | Freeze-dried in glass vial |
| Organism: | Human |
| Protein Name: | Myeloblastin (PRTN3) |
| Purity: | Development Grade: each peptide purified to > 70% (HPLC/MS) |
| Quantification: | No |
| Information | Values |
|---|---|
| Sequence: |
MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP
|
| Specifications: | Peptide scan (15mers with 11 aa overlap) |
Check our list of products, click and go.
Get a quote
-Peptide-Pool.jpg "PepMix™ Human (MAGEA4)")
-Peptide-Pool.jpg "PepMix™ Human (ErbB2_ICD)")