PM-KRAS-MUT1
Pool of 60 peptides derived from a peptide scan (15mers with 11 aa overlap plus selected peptides) through GTPase KRas (Swiss-Prot ID: P01116 (WT)) - contains mutations: G12V, G12C, G12D, G12R, G12A, G13D of Human.
Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.
PepMix™ Peptide Pools
Protein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for
- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)
- In-vitro T cell expansion
- Dendritic cell pulsing
- Immune monitoring
- Cellular immune response profiling
- T cell epitope identification
- Standardization of T cell assays
Benefits of PepMix™
- Each peptide quality controlled and guaranteed for identity and purity
- CoA and HPLC-MS data available
- High batch-to-batch consistency
- No false positive T cell responses by contaminating deletion peptides
- No toxic inhibition of T cell responses due to stringent purification of each peptide
- Minimization of endotoxin contamination due to low bioburden process
- ADCF policy in place
- HLA independent stimulation (with antigen spanning peptide pools)
References
Read References with
PepMix™ Peptide Pools for Tumor Associated Antigens
PepMix™ Control Pools
Application Notes
Cross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccination
Loyal et al (2021) Full text
Peptide Tools to Support the Fight against COVID-19
Alem et al (2020) Full text
CEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverage
Eckey et al. (2017) Full text
Developing Multi-HIV Antigen Specific T-Cells as a Component of a Cure Strategy
Lam et al. (2015) Full text
Peptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell Transplantation
Gary et al. (2015) Full text
PepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell Transplant
Keirnan et al. (2012) Full text
Cytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging Population
Kern (2012) Full text
| Properties | Values |
|---|---|
| Amount: | 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) |
| Application: | T-cell immunity |
| Category: | PepMix Peptide Pools |
| Condition / Topic: | Cancer |
| Layout: | Freeze-dried in glass vial |
| Organism: | Human |
| Protein Name: | GTPase KRas |
| Purity: | Development Grade: each peptide purified to > 70% (HPLC/MS) |
| Quantification: | No |
| Information | Values |
|---|---|
| Sequence: |
MTEYKLVVVGAXXVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM
|
Check our list of products, click and go.
Get a quote