Skip to main content Skip to search Skip to main navigation

About PepMix™ Human MOG (1-125) Peptide Pool

The PepMix™ Human MOG (1-125) peptide pool combines 29 overlapping peptides from a 125-amino-acid region of human myelin oligodendrocyte glycoprotein, corresponding to UniProt Q16653 residues 30-154. Its peptide scan uses 15mers with an 11-amino-acid overlap and is supplied as a pooled reagent for cellular immune assays. This MOG control peptide pool can serve as a negative antigen control when its suitability has been established for the donor samples and assay, because MOG-reactive T cells may produce a response.

PepMix™ Human MOG (1-125) Peptide Pool - Specifications

  • Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)
  • Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) - (equivalent to an average purity of 85%)
  • Delivery Format: Freeze-dried in glass vial
  • Application(s): T-cell Immunity
  • Condition(s)/Topic(s): Control
  • Standard Delivery Time: 2-5 days

Applications

  • Negative antigen-control conditions in ELISpot and intracellular cytokine staining (ICS), following assay-specific qualification.
  • Assessment of cellular reactivity to the covered human MOG region in antigen-specific T-cell assays.
  • Comparison of MOG-stimulated and control conditions in cytokine or proliferation studies.

Human MOG Control Pool for Cellular Immune Assays

PM-MOG belongs to JPT’s Control Pools and provides a defined human self-antigen preparation for T-cell assay workflows. The MOG 1-125 peptide pool covers the specified 125-aa region, rather than the entire precursor sequence. For product selection across formats, visit the MOG peptides overview.

29 Overlapping Peptides in One Pooled Reagent

The pooled format removes the need to combine 29 individual peptide stocks before testing the covered antigen region. Each peptide is purified to >70% by HPLC/MS, and the vial contains 25 µg of each peptide. Stating coverage and per-peptide amount explicitly helps researchers compare antigen inputs and plan control conditions.

Need a different sequence or peptide preparation?
Discuss your project-specific peptide requirements through Custom Peptide Synthesis.

References for PepMix™ Human MOG (1-125) Peptide Pool

References
Read References with
PepMix™ Peptide Pools for Infectious Diseases
COVID-19 related PepMixes™
PepMix™ Control Pools

Application Notes
Cross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccination
Loyal et al (2021) Full text
Peptide Tools to Support the Fight against COVID-19
Alem et al (2020) Full text
CEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverage
Eckey et al. (2017) Full text
Developing Multi-HIV Antigen Specific T-Cells as a Component of a Cure Strategy
Lam et al. (2015) Full text
Peptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell Transplantation
Gary et al. (2015) Full text
PepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell Transplant
Keirnan et al. (2012) Full text
Cytomegalovirus Protein Spanning PepMixTM Peptide Pools to Discover Changes in T-Cell Immunity in the Aging Population
Kern (2012) Full text

Testimonials
"To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our go-to company for purchasing peptides."
Dr. Laura J Pallett, Infection and Immunity, University College London, UK

Documentation for PepMix™ Human MOG (1-125) Peptide Pool

Properties of PepMix™ Human MOG (1-125) Peptide Pool

Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)
Application: T-cell immunity
Category: PepMix Peptide Pools, PepMix Peptide Pools Controls
Condition / Topic: Control
Layout: Freeze-dried in glass vial
Organism: Human
Protein Name: Glycoprotein, Myelin-oligodendrocyte glycoprotein
Purity: >70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS)
Quantification: No

Further Information to PepMix™ Human MOG (1-125) Peptide Pool

Information Values
Sequence:
GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Specifications: Peptide scan (15mers with 11 aa overlap)
Loading...

Check our list of products, click and go.

Get a quote