PM-HPV16-E6

PepMix™ HPV 16 (E6)

US$545.00

In stock

Description

About PepMix™ HPV 16 (E6)

Pool of 37 peptides derived from a peptide scan (15mers with 11 aa overlap) through Protein E6 (Swiss-Prot ID: P03126) of Human Papillomavirus (HPV) - type 16.

PepMix™ HPV 16 (E6) - Specifications

Amount: 25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 10⁸ cells)
Purity: Development Grade: each peptide purified to > 70% (HPLC/MS)
(equivalent to an average purity of 85%)
Delivery Format: Freeze-dried in glass vial
Application(s): T-cell Immunity
Condition(s)/Topic(s): Cancer, Malignant genital cancers, Genital malignancies, Infection
Standard Delivery Time: 2-5 days

Why Choose PepMix™ HPV 16 (E6) for Your Research?

Tailored for High-Impact HPV 16 Research

PepMix™ HPV 16 (E6) peptide pools are essential tools for researchers aiming to understand the T-cell mediated immune response to HPV 16. This product enables high-throughput screening of T-cell epitopes, making it invaluable for vaccine development and immunotherapy research against HPV-related cancers.

Customizable PepMix™ Peptide Pools

In addition to our standard PepMix™ HPV 16 (E6) product, we offer fully customizable PepMix™ peptide pools. Select your sequence, amount, purity, and pool format to match your specific research needs. Our team is here to assist you every step of the way, ensuring that you receive the most precise and reliable peptide tools for your work.

Explore More Peptide Tools for HPV 16 Studies

As leaders in peptide manufacturing, we provide a wide range of peptide tools to support HPV 16 research. Whether you're investigating the immune response to other HPV proteins or need tailored peptide synthesis, our state-of-the-art laboratories in Berlin are equipped to deliver the highest quality products, adhering to the latest ISO 9001:2015 regulations.

Contact us today to discuss your specific needs, or visit our webpage for more Peptide Tools to Study HPV.

Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.

PepMix™ Peptide Pools
Protein-spanning mixtures of overlapping peptides (PepMix™) are extremely efficient for
- Antigen-specific T cell stimulation in T cell assays (e.g. in ELISpot, ICS, cell-mediated cytotoxicity or proliferation assays)
- In-vitro T cell expansion
- Dendritic cell pulsing
- Immune monitoring
- Cellular immune response profiling
- T cell epitope identification
- Standardization of T cell assays

Benefits of PepMix™
- Production ISO 9001 certified
- Each peptide quality controlled and guaranteed for identity and purity
- CoA and HPLC-MS data available
- High batch-to-batch consistency
- No false positive T cell responses by contaminating deletion peptides
- No toxic inhibition of T cell responses due to stringent purification of each peptide
- Minimization of endotoxin contamination due to low bioburden process
- ADCF policy in place
- HLA independent stimulation (with antigen spanning peptide pools)

References

References for PepMix™ HPV 16 (E6)

References
Read References with
PepMix™ Peptide Pools for Infectious Diseases
COVID-19 related PepMixes™
PepMix™ Control Pools

Application Notes
Peptide Tools to Support the Fight against COVID-19
Alem et al (2020) Full text
Developing Multi-HIV Antigen Specific T-Cells as a Component of a Cure Strategy
Lam et al. (2015) Full text
Peptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell Transplantation
Gary et al. (2015) Full text

Testimonials
"To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our go-to company for purchasing peptides."
Dr. Laura J Pallett, Infection and Immunity, University College London, UK

Documentation

Properties

Properties of PepMix™ HPV 16 (E6)

Properties	Values
Amount:	25 µg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells)
Application:	T-cell immunity
Category:	PepMix Peptide Pools, PepMix Peptide Pools Infections
Condition / Topic:	Cancer, Genital malignancies, Infection, Malignant genital cancers
Layout:	Freeze-dried in glass vial
Organism:	Human Papillomavirus (HPV)
Protein Name:	Protein E6
Purity:	>70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS)
Quantification:	Yes

Further Information to PepMix™ HPV 16 (E6)

Information	Values
Sequence:	MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
Specifications:	Peptide scan (15mers with 11 aa overlap)