Skip to main content Skip to search Skip to main navigation

About Pancreatic Polypeptide, Human (CAS: 75976-10-2)

Pancreatic Polypeptide (human) is a peptide hormone, secreted by the pancreas, with high affinity for the NPY Y4 receptor that regulates pancreatic secretion activities. Pancreatic Polypeptide (PP) also affects glycogen storage in the liver and gastrointestinal secretion. For research use only, do not use in humans!

Pancreatic Polypeptide, Human (CAS: 75976-10-2) - Specifications

  • Peptide sequence: H-APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
  • Amount: 1.0 mg net (AAA)
  • Purity: >95% (HPLC-MS)
  • Counterion: TFA
  • Delivery Format: Freeze-dried in plastic vial
  • Chemical formula: C185H287N53O54S2
  • MW (average): 4181.77
  • Application(s): Diabetes research
  • Condition(s)/Topic(s): Diabetes
  • Standard Delivery Time: 2-5 days
  • CAS: 75976-10-2
  • SMILES: O=C(N1CCC[C@H]1C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@@H](CCSC)C(N[C@@H](C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC2=CC=C(O)C=C2)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC3=CC=C(O)C=C3)C(N[C@@H]([C@H](CC)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CCSC)C(N[C@@H](CC(C)C)C(N[C@@H]([C@@H](C)O)C(N[C@@H](CCCNC(N)=N)C(N4[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N)=O)CC5=CC=C(O)C=C5)=O)=O)CCC4)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CCC(N)=O)=O)=O)[C@H]([C@H](O)C)NC([C@H](C)NC([C@H](CC(N)=O)NC([C@H](CC(O)=O)NC(CNC(C(CCC6)N6C([C@H](CC7=CC=C(O)C=C7)NC([C@H](C(C)C)NC([C@@H]8CCCN8C([C@H](CCC(O)=O)NC([C@H](CC(C)C)NC([C@H]9N(C([C@H](C)N)=O)CCC9)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O

Are you interested in other peptides or conjugation to a protein, nucleic acid or lipid? Choose your sequence, amount and purity with our Custom Peptide Synthesis services.

JPT’s Peptides

JPT Peptide Technologies has substantial, long-standing expertise in providing peptides in all formats, scales and modifications to the global scientific community. All our catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

Benefits of JPT’s Peptides

  • All peptides are made in Germany
  • Bulk orders or custom peptide synthesis upon request
  • Provision of freeze-dried aliquots for enhanced stability
  • Proven track record
  • Need the conjugated or modified peptide? Contact us!

References for Pancreatic Polypeptide, Human (CAS: 75976-10-2)

References:
Read References with Specialty Peptides

Testimonial:
"Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle."
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

Testimonial:
Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

Documentation for Pancreatic Polypeptide, Human (CAS: 75976-10-2)

Properties of Pancreatic Polypeptide, Human (CAS: 75976-10-2)

Amount: 1.0 mg net (AAA)
Application: Diabetes research
Category: Diabetes Peptides
Condition / Topic: Diabetes
Layout: Freeze-dried in plastic vial
Organism: Human
Protein Name: Diabetes Peptide
Purity: >95% (HPLC-MS)
Quantification: Yes

Further Information to Pancreatic Polypeptide, Human (CAS: 75976-10-2)

Information Values
Sequence: H-APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
Loading...

Check our list of products, click and go.

Get a quote