Skip to main content Skip to search Skip to main navigation

About Oxyntomodulin - OXM Peptide (CAS: 159002-68-3)

Oxyntomodulin (OXM) is a peptide hormone that is secreted in the small intestine during food intake and plays a role in the feeling of satiety and appetite. Oxyntomodulin is used experimentally for drug-assisted weight loss in obesity, as it reduces feelings of hunger and promotes energy metabolism. Oxyntomodulin is known to bind both GLP-1 receptors and glucagon receptors. If the effects mentioned above are mediated through these receptors or an unidentified receptor is not known. For research use only, do not use in humans!

Oxyntomodulin - OXM Peptide (CAS: 159002-68-3) - Specifications

  • Peptide sequence: H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
  • Amount: 1.0 mg net (AAA)
  • Purity: >95% (HPLC-MS)
  • Counterion: TFA
  • Delivery Format: Freeze-dried in plastic vial
  • Chemical formula: C192H295N61O60S
  • MW (average): 4449.9
  • Application(s): Diabetes research
  • Condition(s)/Topic(s): Diabetes
  • Standard Delivery Time: 2-5 days
  • CAS: 159002-68-3
  • SMILES: N[C@@H](CC1=CNC=N1)C(N[C@@H](CO)C(N[C@@H](CCC(N)=O)C(NCC(N[C@@H]([C@@H](C)O)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H]([C@@H](C)O)C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@@H](CC3=CC=C(O)C=C3)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CC4=CC=C(O)C=C4)C(N[C@@H](CC(C)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CC5=CC=CC=C5)C(N[C@@H](C(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC6=CNC7=C6C=CC=C7)C(N[C@@H](CC(C)C)C(N[C@@H](CCSC)C(N[C@@H](CC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(N)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CCCCN)=O)=O)=O)=O)CO)=O)=O)=O)=O)=O)=O)=O

Are you interested in other peptides or conjugation to a protein, nucleic acid or lipid? Choose your sequence, amount and purity with our Custom Peptide Synthesis services.

JPT’s Peptide Catalog

JPT Peptide Technologies has substantial, long-standing expertise in providing peptides in all formats, scales and modifications to the global scientific community. All our catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

Benefits of JPT’s Peptides

  • All peptides are made in Germany
  • Bulk orders or custom peptide synthesis upon request
  • Provision of freeze-dried aliquots for enhanced stability
  • Proven track record
  • Need the conjugated or modified peptide? Contact us!

References for Oxyntomodulin - OXM Peptide (CAS: 159002-68-3)

References:
Read References with Specialty Peptides

Testimonial:
"Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle."
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

Testimonial:
Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands

Documentation for Oxyntomodulin - OXM Peptide (CAS: 159002-68-3)

Properties of Oxyntomodulin - OXM Peptide (CAS: 159002-68-3)

Amount: 1.0 mg net (AAA)
Application: Diabetes research
Category: Diabetes Peptides
Condition / Topic: Diabetes
Layout: Freeze-dried in plastic vial
Organism: Human
Protein Name: Diabetes Peptide
Purity: >95% (HPLC-MS)
Quantification: Yes

Further Information to Oxyntomodulin - OXM Peptide (CAS: 159002-68-3)

Information Values
Sequence: H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
Loading...