SP-CAT-049
Oxyntomodulin (OXM) is a peptide hormone that is secreted in the small intestine during food intake and plays a role in the feeling of satiety and appetite. Oxyntomodulin is used experimentally for drug-assisted weight loss in obesity, as it reduces feelings of hunger and promotes energy metabolism. Oxyntomodulin is known to bind both GLP-1 receptors and glucagon receptors. If the effects mentioned above are mediated through these receptors or an unidentified receptor is not known. For research use only, do not use in humans!
JPT Peptide Technologies has substantial, long-standing expertise in providing peptides in all formats, scales and modifications to the global scientific community. All our catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.
Benefits of JPT’s PeptidesReferences:
Read References with Specialty Peptides
Testimonial:
"Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle."
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands
Testimonial:
Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands
| Properties | Values |
|---|---|
| Amount: | 1.0 mg net (AAA) |
| Application: | Diabetes research |
| Category: | Diabetes Peptides |
| Condition / Topic: | Diabetes |
| Layout: | Freeze-dried in plastic vial |
| Organism: | Human |
| Protein Name: | Diabetes Peptide |
| Purity: | >95% (HPLC-MS) |
| Quantification: | Yes |
| Information | Values |
|---|---|
| Sequence: | H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH |
Check our list of products, click and go.
Get a quote