Skip to main content Skip to search Skip to main navigation

About mCRAMP (Mouse) Antimicrobial Peptide

mCRAMP (Mouse) Antimicrobial Peptide is high quality antimicrobial peptide or host defence peptide for the development of novel therapeutic agents. mCRAMP (Mouse) Antimicrobial Peptide shows antibacterial activity. The mCRAMP (Mouse) Antimicrobial Peptide, GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ (Uniprot: AAB88303.1) from JPT is produced under strict quality control and quality.

mCRAMP (Mouse) Antimicrobial Peptide - Specifications

  • Peptide sequence: H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH
  • Amount: 0.5 mg
  • Purity: >95% (HPLC-MS)
  • Counterion: TFA
  • Delivery Format: Freeze-dried in plastic vial
  • Application(s): Proteomics
  • Condition(s)/Topic(s): Antimicrobial
  • Standard Delivery Time: approx. 3 weeks
  • CAS: 376364-36-2

Are you interested in other peptides or conjugation to a protein, nucleic acid or lipid? Choose your sequence, amount and purity with our Custom Peptide Synthesis services.

Antimicrobial peptides (AMPs), also called host defence peptides (HDPs) are part of the innate immune response found in most organisms. Antimicrobial peptides are potential targets for the development of novel therapeutic agents. They have been shown to kill bacteria, viruses, and fungi and even transformed or cancerous cells using different modes of action such as destabilizing membranes or forming transmembrane channels.
More than 2600 AMPs have been identified so far. If you are interested in custom peptide synthesis of antimicrobial peptides, please request a quote!

Benefits of JPT’s Peptides

  • All peptides are made in Germany
  • Bulk orders or custom peptide synthesis upon request
  • Provision of freeze-dried aliquots for enhanced stability
  • Proven track record
  • Need the conjugated or modified peptide? Contact us!

References for mCRAMP (Mouse) Antimicrobial Peptide

References:
Read References with Specialty Peptides

Documentation for mCRAMP (Mouse) Antimicrobial Peptide

Properties of mCRAMP (Mouse) Antimicrobial Peptide

Amount: 0.5 mg
Application: Proteomics
Category: Antimicrobial Peptides
Condition / Topic: Antimicrobial
Layout: Freeze-dried in plastic vial
Modification: None
Organism: Mouse
Purity: >95% (HPLC-MS)
Quantification: No

Further Information to mCRAMP (Mouse) Antimicrobial Peptide

Information Values
Sequence: H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH
Specifications: Antimicrobial peptide
Loading...

Check our list of products, click and go.

Get a quote