LL-37 Peptide

LL-37 Peptide (human) is high quality cathelicidin-derived antimicrobial peptide or host defence peptide for the development of novel therapeutic agents. LL-37 Peptide shows antibacterial, antifungal and antiviral activity. The LL-37 Peptide (human), [LL-37, 37 aa] (Uniprot: P49913) from JPT is produced under strict quality control and quality.

LL-37 Peptide - Specifications

• Peptide sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH
• Amount: 0.5 mg
• Purity: >95% (HPLC-MS)
• Counterion: TFA
• Delivery Format: Freeze-dried in plastic vial
• Application(s): Proteomics
• Condition(s)/Topic(s): Antimicrobial
• Standard Delivery Time: approx. 3 weeks
• CAS: 154947-66-7

Antimicrobial peptides (AMPs), also called host defence peptides (HDPs) are part of the innate immune response found in most organisms. Antimicrobial peptides are potential targets for the development of novel therapeutic agents. They have been shown to kill bacteria, viruses, and fungi and even transformed or cancerous cells using different modes of action such as destabilizing membranes or forming transmembrane channels.
More than 2600 AMPs have been identified so far. If you are interested in custom peptide synthesis of antimicrobial peptides, please request a quote!

Benefits of JPT’s Peptides

• All peptides are made in Germany
• Bulk orders or custom peptide synthesis upon request
• Provision of freeze-dried aliquots for enhanced stability
• Proven track record
• Need the conjugated or modified peptide? Contact us!