Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
Description
About Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
Glucagon-like peptide 1 (1-37) GLP-1 is an endogenous GLP-1 receptor ligand in truncated form of GLP-1. GLP1 is an insulinotropic hormone and belongs to the GLP-1 receptor agonists that stimulate the release of insulin, reduce glucagon secretion, and slow down gastric emptying, which helps regulate blood sugar levels. For research use only, do not use in humans!
Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3 - Specifications
- Peptide sequence: H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
- Amount: 0.5 mg net (AAA)
- Purity: >95% (HPLC-MS)
- Counterion: TFA
- Delivery Format: Freeze-dried in plastic vial
- Application(s): Diabetes research
- Condition(s)/Topic(s): Diabetes
- Standard Delivery Time: 2-5 days
- CAS: 87805-34-3
- SMILES: SMILES: N[C@@H](CC1=CNC=N1)C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC3=CNC=N3)C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H]([C@@H](C)O)C(N[C@@H](CC4=CC=CC=C4)C(N[C@@H]([C@@H](C)O)C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CC5=CC=C(O)C=C5)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC6=CC=CC=C6)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](CC7=CNC8=C7C=CC=C8)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCCNC(N)=N)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CO)=O)=O)=O)=O)CO)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O
Are you interested in other peptides or conjugation to a protein, nucleic acid or lipid? Choose your sequence, amount and purity with our Custom Peptide Synthesis services.
JPT’s Diabetes Peptide%3b GLP-1 receptor agonists
Glucagon-like Peptide 1 (GLP-1) and other GLP-1 receptor agonists have proven to be an effective treatment of Type 2 diabetes and obesity, offering significant benefits. They improve glycemic control by enhancing insulin secretion in response to elevated blood glucose levels; help reduce glucagon levels, further supporting blood sugar regulation; and slow gastric emptying, leading to weight loss, which is beneficial for diabetic patients who are obese. JPT Peptide Technologies has substantial, long-standing expertise in providing peptides in all formats, scales and modifications to the global scientific community. All our catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.
Benefits of JPT’s Peptides- All peptides are made in Germany
- Bulk orders or custom peptide synthesis upon request
- Provision of freeze-dried aliquots for enhanced stability
- Proven track record
- Need the conjugated or modified peptide? Contact us!
References
References for Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
References:
Read References with Specialty Peptides
Testimonial:
"Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle."
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands
Testimonial:
Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source.We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands
Documentation
Documentation for Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
Properties
Properties of Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
Properties | Values |
---|---|
Amount: | 0.5 mg net (AAA) |
Application: | Diabetes research |
Category: | Diabetes Peptides |
Condition / Topic: | Diabetes |
Layout: | Freeze-dried in plastic vial |
Organism: | Human |
Protein Name: | GLP-1 |
Purity: | >95% (HPLC-MS) |
Quantification: | Yes |
Further Information to Glucagon-like Peptide 1 (1-37) GLP-1 - CAS 87805-34-3
Information | Values |
---|---|
Sequence: | H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH |