Exendin-4 (CAS: 141758-74-9)

Exendin-4 was initially isolated from the venom of Gila monster lizard (Heloderma suspectum). It mimics the activity of mammalian incretin hormone glucagon-like peptide 1 (GLP-1), acting as a GLP-1 receptor agonist. Therefore, it is able to control the secretion of insulin in a glucose dependent manner, the negative regulation of high glucagon secretion, and the increased duration of stomach emptying. Exendin-4 also promotes neogeneration and proliferation of β-cells, aiding in the regeneration of pancreas. It acts as a ligand to exendin receptor. For research use only, do not use in humans!

Exendin-4 (CAS: 141758-74-9) - Specifications

• Peptide sequence: H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• Amount: 1.0 mg net (AAA)
• Purity: >95% (HPLC-MS)
• Counterion: TFA
• Delivery Format: Freeze-dried in plastic vial
• Application(s): Diabetes research
• Condition(s)/Topic(s): Diabetes
• Standard Delivery Time: 2-5 days
• CAS: 141758-74-9
• SMILES: N[C@@H](CC1=CNC=N1)C(NCC(N[C@@H](CCC(O)=O)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H]([C@H](O)C)C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H](CO)C(N[C@@H](CCCCN)C(N[C@@H](CCC(N)=O)C(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC4=CNC5=C4C=CC=C5)C(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N[C@@H](CC(N)=O)C(NCC(NCC(N6[C@H](C(N[C@@H](CO)C(N[C@@H](CO)C(NCC(N[C@@H](C)C(N7CCC[C@H]7C(N8CCC[C@H]8C(N9CCC[C@H]9C(N[C@@H](CO)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)CCC6)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)C)=O)=O)=O)=O)CCSC)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O

JPT’s Diabetes Peptide%3b GLP-1 receptor agonists

Glucagon-like Peptide 1 (GLP-1) and other GLP-1 receptor agonists have proven to be an effective treatment of Type 2 diabetes and obesity, offering significant benefits. They improve glycemic control by enhancing insulin secretion in response to elevated blood glucose levels; help reduce glucagon levels, further supporting blood sugar regulation; and slow gastric emptying, leading to weight loss, which is beneficial for diabetic patients who are obese. JPT Peptide Technologies has substantial, long-standing expertise in providing peptides in all formats, scales and modifications to the global scientific community. All our catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.

• All peptides are made in Germany
• Bulk orders or custom peptide synthesis upon request
• Provision of freeze-dried aliquots for enhanced stability
• Proven track record
• Need the conjugated or modified peptide? Contact us!