Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
Description
About Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
Set of 8 Matrix Pools and 16 individual overlapping peptides spanning Envelope protein of SARS-CoV-2 (Severe Acute Respiratory Syndrome-Related Coronavirus 2) for epitope identification and mapping.
Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP) - Specifications
Amount: 5 µg / peptide as individual peptide and in matrix poolsPurity: Research Plus Grade: each peptide is guaranteed to be main product (HPLC/MS)
Delivery Format: Freeze-dried in 2 x 96 tube racks
Application(s): T-cell Immunity
Condition(s)/Topic(s): Covid-19, Infection, Respiratory infection
Standard Delivery Time: 2-5 days
Visit our webpage for more information on SARS-CoV-2, its mutations & variants and our corresponding products.
Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.
Epitope Mapping Peptide Set (EMPS)
Matrix Pools enable fast identification of epitopes within an antigen while consuming minimal amounts of material. From a given antigen overlapping peptides are generated and pooled into many subpools, where each peptide is present in two subpools according to a layout that we design for each antigen. In combination with all individual peptides of the matrix you are able to identify and confirm epitopes quickly and efficiently.
Benefits of Epitope Mapping Peptide Set (EMPS)
- Fast epitope identification
- Minimal amounts of sample required
- Set includes individual peptides for confirmation and validation
References
References for Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
References
Read References with
PepMix™ Peptide Pools for Infectious Diseases
COVID-19 related PepMixes™
PepMix™ Control Pools
Application Notes
Peptide Tools to Support the Fight against COVID-19
Alem et al (2020) Full text
Developing Multi-HIV Antigen Specific T-Cells as a Component of a Cure Strategy
Lam et al. (2015) Full text
Peptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell Transplantation
Gary et al. (2015) Full text
Testimonials
"To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our "go-to" company for purchasing peptides."
Dr. Laura J Pallett, Infection and Immunity, University College London, UK
Documentation
Documentation for Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
Properties
Properties of Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
Properties | Values |
---|---|
Amount: | 5 µg / peptide as individual peptide and in matrix pools |
Application: | T-cell immunity |
Category: | Epitope Mapping Peptide Sets, PepMix Peptide Pools |
Condition / Topic: | Covid-19, Infection, Respiratory infection |
Layout: | Freeze-dried in 1 x 96 tube rack, Freeze-dried in 2 x 96 tube racks |
Organism: | SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) |
Protein Name: | Envelope protein |
Purity: | Research Plus Grade: each peptide is guaranteed to be main product (HPLC/MS), crude (major peak by LC-MS is guaranteed to be peptide of interest for each peptide) |
Quantification: | Yes |
Further Information to Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
Information | Values |
---|---|
Sequence: | MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV |
Specifications: | Peptide scan (optimized scan into 15 mers) |
Quality Assurance
All production is ISO 9001:2015 certified.