Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
Description
About Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
Set of 8 Matrix Pools and 16 individual overlapping peptides spanning Envelope protein of SARS-CoV-2 (Severe Acute Respiratory Syndrome-Related Coronavirus 2) for epitope identification and mapping.
Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP) - Specifications
- Amount: 5 µg / peptide as individual peptide and in matrix pools
- Purity: Research Plus Grade: each peptide is guaranteed to be main product (HPLC/MS)
- Delivery Format: Freeze-dried in 2 x 96 tube racks
- Application(s): T-cell Immunity
- Condition(s)/Topic(s): Covid-19, Infection, Respiratory infection
- Standard Delivery Time: 2-5 days
Visit our webpage for more information on SARS-CoV-2, its mutations & variants and our corresponding products.
Are you interested in your own custom PepMix? Choose your sequence, amount, purity and pool format. We will assist you along the way. Custom PepMix Peptide Pools.
Epitope Mapping Peptide Set (EMPS)
Matrix Pools enable fast identification of epitopes within an antigen while consuming minimal amounts of material. From a given antigen overlapping peptides are generated and pooled into many subpools, where each peptide is present in two subpools according to a layout that we design for each antigen. In combination with all individual peptides of the matrix you are able to identify and confirm epitopes quickly and efficiently.
Benefits of PepMix™
- Each peptide quality controlled and guaranteed for identity and purity
- CoA and HPLC-MS data available
- High batch-to-batch consistency
- No false positive T cell responses by contaminating deletion peptides
- No toxic inhibition of T cell responses due to stringent purification of each peptide
- Minimization of endotoxin contamination due to low bioburden process
- ADCF policy in place
- HLA independent stimulation (with antigen spanning peptide pools)
References
References for Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
References:
Read References with PepMix™ Peptide Pools - Infectious Diseases & COVID-19 related publications
Application Notes
Cross-reactive T cells enhance immune responses in SARS-CoV-2 infection and vaccination
Loyal et al (2021) Full text
Peptide Tools to Support the Fight against COVID-19
Alem et al (2020) Full text
CEFX/EFX Ultra SuperStim Pools: Superior positive controls for T-cell assays with broad MHC-allele and antigen coverage
Eckey et al. (2017) Full text
Developing Multi-HIV Antigen Specific T-Cells as a Component of a Cure Strategy
Lam et al. (2015) Full text
Peptide-stimulated Expansion of Virus-specific T cells For Preventative Treatment After Allogeneic Stem Cell Transplantation
Gary et al. (2015) Full text
PepMix™ Peptide Pools for Clinical Applications: T Cell Therapy for Viral Infections after Hematopoietic Stem Cell Transplant
Keirnan et al. (2012) Full text
Cytomegalovirus Protein Spanning PepMix™ Peptide Pools to Discover Changes in T-Cell Immunity in the Aging Population
Kern (2012) Full text
"To establish a novel role for myeloid derived suppressor cells (Pallett et al, Nat. Med. 2015) in chronic viral infection, we utilised the PepMix CEF Pool (extended) as well as a custom synthesized PepMix spanning the core region of HBV genotype D . Whereas, the CEF peptide pool consists of 32 peptides, each corresponding to a defined HLA class I-restricted T-cell epitope from Cytomegalo, Epstein-Barr, and Influenza virus, the latter custom PepMix included 15meric peptides overlapping by 10 amino acids. Specifically this composition enabled us to monitor both the antiviral CD8+ and CD4+ T cell responses in chronic HBV infection and the non-antigen specific T cells that are known to mediate immunopathology in the liver. Our entire experience with JPT, from ordering/delivery to use in the lab was excellent. Not only were the reagents able to perform reliably and consistently in vitro from batch to batch, the customer and technical support provided was continually available and efficient when needed. JPT will remain our "go-to" company for purchasing peptides."
Dr. Laura J Pallett, Infection and Immunity, University College London, UK
Documentation
Documentation for Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
Properties
Properties of Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
| Properties | Values |
|---|---|
| Amount: | 5 µg / peptide as individual peptide and in matrix pools |
| Application: | T-cell immunity |
| Category: | Epitope Mapping Peptide Sets, PepMix Peptide Pools |
| Condition / Topic: | Covid-19, Infection, Respiratory infection |
| Layout: | Freeze-dried in 1 x 96 tube rack, Freeze-dried in 2 x 96 tube racks |
| Organism: | SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) |
| Protein Name: | Envelope protein |
| Purity: | Research Plus Grade: each peptide is guaranteed to be main product (HPLC/MS), crude (major peak by LC-MS is guaranteed to be peptide of interest for each peptide) |
| Quantification: | No |
Further Information to Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)
| Information | Values |
|---|---|
| Sequence: | MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV |
| Specifications: | Peptide scan (optimized scan into 15 mers) |