SP-CAT-138
Cecropin A Peptide is high quality antimicrobial peptide or host defence peptide for the development of novel therapeutic agents. Cecropin A Peptide shows antibacterial activity. The Cecropin A Peptide, KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK (Uniprot: P01507) from JPT is produced under strict quality control and quality.
Antimicrobial peptides (AMPs), also called host defence peptides (HDPs) are part of the innate immune response found in most organisms. Antimicrobial peptides are potential targets for the development of novel therapeutic agents. They have been shown to kill bacteria, viruses, and fungi and even transformed or cancerous cells using different modes of action such as destabilizing membranes or forming transmembrane channels.
More than 2600 AMPs have been identified so far. If you are interested in custom peptide synthesis of antimicrobial peptides, please request a quote!
Benefits of JPT’s Peptides
References:
Read References with Specialty Peptides
| Properties | Values |
|---|---|
| Amount: | 0.5 mg |
| Application: | Proteomics |
| Category: | Antimicrobial Peptides |
| Condition / Topic: | Antimicrobial |
| Layout: | Freeze-dried in plastic vial |
| Modification: | None |
| Organism: | Insect |
| Protein Name: | Cecropin |
| Purity: | >95% (HPLC-MS) |
| Quantification: | No |
| Information | Values |
|---|---|
| Sequence: | H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |
| Specifications: | Antimicrobial peptide |
Check our list of products, click and go.
Get a quote