SP-CAT-105

Cecropin B, 80451-05-4

US$443.12

In stock

Description

About Cecropin B, 80451-05-4

Cecropin B, 80451-05-4 (Uniprot: P01508) is a membrane-disrupting peptide from Hyalophora cecropia for cancer-targeting research. The Cecropin B, 80451-05-4 peptide, H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 from JPT is produced under strict quality control and quality management.

Cecropin B, 80451-05-4 - Specifications

  • Peptide sequence: H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
  • Amount: 0.5 mg
  • Purity: > 90% (HPLC/MS)
  • Counterion: TFA
  • Delivery Format: Freeze-dried in plastic vial
  • Application(s): Cancer research
  • Condition(s)/Topic(s): Cancer
  • Standard Delivery Time: approx. 3 weeks
Are you interested in other non-RGD cancer peptides?
Choose sequence, amount and purity. We will assist you along the way: Custom Peptide Synthesis

Non-RGD Cancer Peptides from JPT

Cancer peptides are widely used to develop targeted diagnostic and therapeutic approaches. They offer different functionalities such as binding tumor-associated receptors, interacting with cellular membranes, or interfering with tumor microenvironment. Depending on the application, these mechanisms enable specific delivery, tumor imaging, and tumor cell killing with low side effects.
JPT offers a wide portfolio of high-quality cancer peptides engineered for robust and reproducible research in oncology including RGD and non-RGD cancer peptides.

Benefits of JPT’s Non-RGD Cancer Peptides

  • Each peptide quality controlled and guaranteed for identity and purity
  • CoA and HPLC-MS data available
  • High batch-to-batch consistency
  • Synthesis protocols designed to avoid toxic contaminants and side products
  • Provision of freeze dried aliquots for enhanced stability
  • Proven track record for applications in clinical studies

References

References for Cecropin B, 80451-05-4

References
Read References with Peptides made by JPT
NAME is described in
Natriuretic peptides modulate monocyte-derived Langerhans cell differentiation and promote a migratory phenotype
Horvath et al

Documentation

Documentation for Cecropin B, 80451-05-4

Properties

Properties of Cecropin B, 80451-05-4

Properties Values
Amount: 0.5 mg
Application: Cancer biomarker research
Category: Cancer peptides
Layout: Freeze-dried in plastic vial
Organism: Hyalophora
Protein Name: Cecropin
Purity: >90% (HPLC-MS)
Quantification: No

Further Information to Cecropin B, 80451-05-4

Information Values
Sequence: H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Specifications: 35mer cancer peptide
Loading...

Check our list of products, click and go.

Get a quote