SP-CAT-105
Cecropin B, 80451-05-4 (Uniprot: P01508) is a membrane-disrupting peptide from Hyalophora cecropia for cancer-targeting research. The Cecropin B, 80451-05-4 peptide, H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 from JPT is produced under strict quality control and quality management.
Cancer peptides are widely used to develop targeted diagnostic and therapeutic approaches. They offer different functionalities such as binding tumor-associated receptors, interacting with cellular membranes, or interfering with tumor microenvironment. Depending on the application, these mechanisms enable specific delivery, tumor imaging, and tumor cell killing with low side effects.
JPT offers a wide portfolio of high-quality cancer peptides engineered for robust and reproducible research in oncology including RGD and non-RGD cancer peptides.
Benefits of JPT’s Non-RGD Cancer Peptides
References
Read References with Peptides made by JPT
NAME is described in
Natriuretic peptides modulate monocyte-derived Langerhans cell differentiation and promote a migratory phenotype
Horvath et al
| Properties | Values |
|---|---|
| Amount: | 0.5 mg |
| Application: | Cancer biomarker research |
| Category: | Cancer peptides |
| Layout: | Freeze-dried in plastic vial |
| Organism: | Hyalophora |
| Protein Name: | Cecropin |
| Purity: | >90% (HPLC-MS) |
| Quantification: | No |
| Information | Values |
|---|---|
| Sequence: | H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
| Specifications: | 35mer cancer peptide |
Check our list of products, click and go.
Get a quote