Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein (Swiss-Prot ID: P05067). HFIP treatment is performed to disrupt beta-sheets and other unwanted secondary structures.
Beta-Amyloid (1-40) Scrambled HFIP treated - Specifications
Peptide Sequence: AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Protein Name: Amyloid beta (A4) (
alternative names: Abeta, Beta amyloid, APP)
- Purity: >95% (HPLC-MS)
- Delivery Format: Freeze-dried in plastic vial
- CAS: 1678415-68-3
- Application(s):
- Condition(s)/Topic(s): Alzheimer's disease
- Standard Delivery Time: approx. 3 weeks
Visit our webpage for more Peptide Tools to Study Alzheimer's Disease
Are you interested in your other Abeta Peptides? Choose your sequence, amount and purity. We will assist you along the way. Custom Peptide Synthesis.
JPT's Single Catalog Peptides
JPT Peptide Technologies has substantial, long-standing expertise in providing peptides, peptidomimetics, and proteins to the global scientific community. Our highly skilled and committed scientific staff ensures that the most appropriate methods and techniques are selected for every synthesis project. All of JPT's catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.
Benefits of JPT's Single Catalog Peptides
- Synthesis protocols designed to avoid toxic contaminants and side products
- Provision of freeze dried aliquots for enhanced stability
- Proven track record for applications in clinical studies