SP-Ab-27_0.5
A2V-Beta-Amyloid (1-40) HFIP treated


Quality Assurance
All production is performed according to ISO 9001:2015 standards.
Synthetic peptide derived from the N-terminal region of human Amyloid beta A4 protein (Swiss-Prot ID: P05067). HFIP treatment is performed to disrupt beta-sheets and other unwanted secondary structures.
Amino Acid Sequence: DVEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Protein Name: Amyloid beta (A4) (alternative names: Abeta, Beta amyloid, APP)
Purity: >95% (HPLC-MS)
Delivery Format: Freeze-dried in plastic vial
Application(s):
Indication(s)/Topic(s): Alzheimer's disease
Delivery Time: 2-5 days
JPT's Amyloid Beta A4 Peptides (A Beta Peptides)
JPT Peptide Technologies has substantial, long-standing expertise in providing peptides, peptidomimetics, and proteins to the global scientific community. Our highly skilled and committed scientific staff ensures that the most appropriate methods and techniques are selected for every synthesis project. All of JPT's catalog peptides are provided with HPLC-MS analyses to confirm the identity and demonstrate the high quality of our peptides.
Benefits of JPT's Amyloid Beta A4 Peptides (A Beta Peptides)
- Whole production performed in a regulated European environment according to DIN EN ISO 9001:2015 & GCLP standards; Audits welcome!
- Provided as HFIP-films to guarantee chemically and structurally homogenous material without any unwanted secondary structures
- Greatest variety of Abeta sequence modifications in stock - available within days!
- Provision of freeze dried aliquots for enhanced stability
- Not found what you are looking for? Request a quote for custom peptide synthesis
References:
Read References with Amyloid Beta A4 Peptides (abeta, aß)
Application Note
Synthetic Amyloid Beta Peptides Aid Alzheimer Investigation
Broersen et al., Application Note (2013) (full text)
Testimonial
“Our group focuses on the in vitro study of risk factors in Alzheimer’s disease and, as we experienced that the in-house expression and production of the amyloid beta peptide is notoriously difficult, we are continuously dependent on a high quality supply of a large variety of these peptides from commercial source. We started our collaboration with JPT with their request to test a range of their peptides for the ability to produce toxic oligomers and fibrillar networks and were impressed by the rapid supply of a very wide range of high purity peptides with excellent fibril forming properties and toxicity profiles. JPT has shown real valuable know-how and experience in the field of peptide synthesis by their ability to generate high quality preparations of amyloid beta peptide variants which are known for their difficulty to handle.”
Kerensa Broersen, Assistant Prof., Nanobiophysics Group, University of Twente, Enschede, The Netherlands
Properties | Values |
---|---|
Category: | Abeta & Prion Peptides |
Indication / Topic: | Alzheimer's disease |
Organism: | Homo sapiens (Human) |
Protein Name: | Amyloid beta (A4) protein |
Information | Values |
---|---|
Sequence: | DVEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Specifications: | Point mutated synthetic A beta peptide (1-40) |
All production is performed according to ISO 9001:2015 standards.